Marmota marmota marmota (Alpine marmot): 107156486 Help Entry 107156486         CDS       T09644                                  Name (RefSeq) interferon alpha-5-like   KO K05414   interferon alpha Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04060   Cytokine-cytokine receptor interaction mmma04151   PI3K-Akt signaling pathway mmma04217   Necroptosis mmma04620   Toll-like receptor signaling pathway mmma04621   NOD-like receptor signaling pathway mmma04622   RIG-I-like receptor signaling pathway mmma04623   Cytosolic DNA-sensing pathway mmma04630   JAK-STAT signaling pathway mmma04650   Natural killer cell mediated cytotoxicity mmma04936   Alcoholic liver disease mmma05152   Tuberculosis mmma05160   Hepatitis C mmma05161   Hepatitis B mmma05162   Measles mmma05163   Human cytomegalovirus infection mmma05164   Influenza A mmma05165   Human papillomavirus infection mmma05167   Kaposi sarcoma-associated herpesvirus infection mmma05168   Herpes simplex virus 1 infection mmma05169   Epstein-Barr virus infection mmma05170   Human immunodeficiency virus 1 infection mmma05171   Coronavirus disease - COVID-19 mmma05200   Pathways in cancer mmma05320   Autoimmune thyroid disease mmma05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     107156486    04151 PI3K-Akt signaling pathway     107156486   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107156486  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     107156486  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107156486    04621 NOD-like receptor signaling pathway     107156486    04622 RIG-I-like receptor signaling pathway     107156486    04623 Cytosolic DNA-sensing pathway     107156486    04650 Natural killer cell mediated cytotoxicity     107156486  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107156486   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107156486    05161 Hepatitis B     107156486    05160 Hepatitis C     107156486    05171 Coronavirus disease - COVID-19     107156486    05164 Influenza A     107156486    05162 Measles     107156486    05168 Herpes simplex virus 1 infection     107156486    05163 Human cytomegalovirus infection     107156486    05167 Kaposi sarcoma-associated herpesvirus infection     107156486    05169 Epstein-Barr virus infection     107156486    05165 Human papillomavirus infection     107156486   09171 Infectious disease: bacterial    05152 Tuberculosis     107156486   09163 Immune disease    05320 Autoimmune thyroid disease     107156486   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107156486   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     107156486  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmma04052]     107156486 Cytokines and neuropeptides [BR:mmma04052]  Cytokines   Interferons    107156486 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon GH123_cat Motif Other DBs NCBI-GeneID:  107156486 NCBI-ProteinID:  XP_015358046 Ensembl:  ENSMMMG00000005986 UniProt:  A0A8C5YYB8 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MALPLAFLLALMVFNCKSTCSLGCDLPQIHNLGLETSDGNEVGALTLLEKMRKIRTFSCL NYRKDFAFPQEQLEGEQVQKTQAVAVLHEMTHQIFNLFSTQEAFAAWDKTLLDTFLTGLH QHLDDLKACGTQQVGVEEAPLRAVRKYFHRITVYLKEKKYLPCAWEVVRAEIMKSFSSSA NLYGRLRSME NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttggctttcctgctggccctgatggtgttcaactgcaagtccacctgc tctctgggctgtgacctgcctcagatacacaacctgggtcttgaaacttctgacggaaat gaggtgggagccctgacactcctggaaaaaatgaggaaaattcgcactttctcctgcctg aactacagaaaggactttgccttcccccaggagcagttggagggtgagcaggtgcagaag actcaagctgttgctgtcctccatgagatgacccatcagatcttcaacctcttcagcacc caggaggcctttgctgcttgggacaagaccctcctggacaccttcctcactggcctccat cagcatctggatgacctgaaagcctgtgggacccagcaggtgggggtggaagaggctccc ctgagggctgtgaggaaatacttccacaggatcactgtctacctgaaggagaagaaatac ctgccttgtgcctgggaggtggtcagagcagaaatcatgaaatccttctcttcatcagcc aacttgtatggaagactaaggagcatggaatga

DBGET integrated database retrieval system