Marmota marmota marmota (Alpine marmot): 107161007 Help Entry 107161007         CDS       T09644                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04360   Axon guidance mmma04666   Fc gamma R-mediated phagosome formation mmma04810   Regulation of actin cytoskeleton mmma05133   Pertussis mmma05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:mmma00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     107161007  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     107161007   09158 Development and regeneration    04360 Axon guidance     107161007  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107161007   09171 Infectious disease: bacterial    05133 Pertussis     107161007  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmma04131]     107161007   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmma04812]     107161007    04147 Exosome [BR:mmma04147]     107161007 Membrane trafficking [BR:mmma04131]  Others   Actin-binding proteins    Others     107161007 Cytoskeleton proteins [BR:mmma04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      107161007 Exosome [BR:mmma04147]  Exosomal proteins   Proteins found in most exosomes    107161007 SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Mt_ATP-synt_B Motif Other DBs NCBI-GeneID:  107161007 NCBI-ProteinID:  XP_048642248 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPD KDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKRLTGIKHELQA NCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaggtacgcaagtcttcaacgccagaggaagtgaagaagcgtaagaaggcagtgctc ttctgcctgagtgaggacaagaagaacatcatcttggaggagggcaaggagatcctggta ggtgatgtgggccagaccgtggatgatccctacgccacctttgtcaagatgctgccagac aaggactgccgctatgccctctatgacgctacctacgagaccaaggagagcaagaaagag gacctggtgtttatcttctgggcccctgaatccgcacctcttaagagcaaaatgatctat gctagttccaaggacgccatcaagaagaggctgacagggatcaagcacgaattacaagca aactgctatgaggaggtcaaggaccgctgcaccctggctgaaaaactggggggcagtgcc gtcatctctctggagggcaagcctttgtga

DBGET integrated database retrieval system