Marmota marmota marmota (Alpine marmot): 125615615 Help Entry 125615615         CDS       T09644                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04613   Neutrophil extracellular trap formation mmma05034   Alcoholism mmma05203   Viral carcinogenesis mmma05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmma00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125615615  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125615615   09163 Immune disease    05322 Systemic lupus erythematosus     125615615   09165 Substance dependence    05034 Alcoholism     125615615  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     125615615 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125615615 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  125615615 NCBI-ProteinID:  XP_048655875 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtcgcggcaaaggagggaaaggcctgggcaagggcggcgccaagcgccaccgc aaagtcctgcgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcccgc cgtggcggcgtcaagcgcatctccgggctcatctacgaggagacccgcggcgtgctcaag gtgtttctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcggcggctga

DBGET integrated database retrieval system