Mycolicibacterium monacense: EWR22_05850 Help Entry EWR22_05850       CDS       T08739                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmon  Mycolicibacterium monacense Pathway mmon01100   Metabolic pathways mmon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EWR22_05850    00074 Mycolic acid biosynthesis     EWR22_05850   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EWR22_05850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QHP84930 LinkDB All DBs Position 1240273..1240533 Genome browser AA seq 86 aa AA seqDB search MTKSEQQIRDDVVAVLTRIAPEVEADQLEENEPLREQVDLDSMDWLNFLVGVHKQFDVEI PESDYAKLRTVASIVRYIEERRPGSA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgacgaagagcgagcagcagatccgcgatgacgtcgtggccgtgttgaccaggatcgca ccggaggtggaggccgaccagttggaggagaatgagccgctccgcgagcaagtcgacctc gattccatggactggctcaacttccttgtcggtgtccacaaacagttcgatgtcgagatc cccgagtccgactacgcgaaactgcgaacagtggcgagcatcgtgcgctacatcgaagag cgccgaccgggatcggcgtga

DBGET integrated database retrieval system