Mycolicibacterium monacense: EWR22_17915 Help Entry EWR22_17915       CDS       T08739                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mmon  Mycolicibacterium monacense Pathway mmon00261   Monobactam biosynthesis mmon01100   Metabolic pathways mmon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmon00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EWR22_17915  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mmon01008]     EWR22_17915 Polyketide biosynthesis proteins [BR:mmon01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EWR22_17915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH MC_hydratase Motif Other DBs NCBI-ProteinID:  QHP87080 LinkDB All DBs Position complement(3743283..3743498) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDENGRFYVLVNDEEQHSLWPTFADVPAGWRVVFGEATRAECLAYVEQNWTDLR PRSLREAMASE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt ttgagcaccaacccattcgatgacgagaacggccgcttctacgtcctggtgaacgacgag gagcagcacagcctgtggccgacgttcgccgacgtgcccgcggggtggcgcgtggtcttc ggagaggccacccgcgcggagtgcctggcctacgtcgagcagaactggacggatctgcgg ccccgcagcctgcgtgaggcgatggcctcggagtag

DBGET integrated database retrieval system