Mycolicibacterium moriokaense: MMOR_35790 Help Entry MMOR_35790        CDS       T06887                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism mmor  Mycolicibacterium moriokaense Pathway mmor03060   Protein export mmor03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mmor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MMOR_35790  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MMOR_35790  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mmor02044]     MMOR_35790 Secretion system [BR:mmor02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    MMOR_35790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BBX02643 UniProt:  A0AAD1M743 LinkDB All DBs Position complement(3624779..3625063) Genome browser AA seq 94 aa AA seqDB search MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKSEIKEMQSDSKQDTPGSDVA GRAAPAATPIASERADTAAAPAPEAAPPPDQRPA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttgggcggtctacaaccctggcattgggtaatcgtcatcgcggtgttcgtgctgctcttc ggcgccaagaagctcccggacgcggcgcgttcgcttggcaagtcgatgcggatcttcaag tccgagatcaaggagatgcagtccgactccaagcaggacacgcccggatccgatgtcgcc ggccgggcggctccggcggcgacgccgatcgcctcggaacgcgccgacactgcggccgca ccggctccggaggctgcaccgccgccggaccagcgaccggcctga

DBGET integrated database retrieval system