Methylomonas montana: QZJ86_06695 Help Entry QZJ86_06695       CDS       T09581                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mmot  Methylomonas montana Pathway mmot02024   Quorum sensing mmot03018   RNA degradation Brite KEGG Orthology (KO) [BR:mmot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     QZJ86_06695 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     QZJ86_06695 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mmot03019]     QZJ86_06695 (hfq)    03036 Chromosome and associated proteins [BR:mmot03036]     QZJ86_06695 (hfq) Messenger RNA biogenesis [BR:mmot03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      QZJ86_06695 (hfq) Chromosome and associated proteins [BR:mmot03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     QZJ86_06695 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  WKJ91822 LinkDB All DBs Position 1416044..1416286 Genome browser AA seq 80 aa AA seqDB search MSKAQNLQDNFLNALRKEHTPVSIFLVNGIKLQGRVDSFDQYVVMLKNTVNQMVYKHAIS TIVPGKNVTMHREADVSDES NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaagcccaaaacttgcaggacaactttttaaatgccctgagaaaagaacatacc ccggtatctatatttttggttaatggtatcaaactgcaaggccgtgtcgattctttcgac caatatgtggtgatgctgaaaaataccgtcaatcaaatggtctacaagcacgccatatcc accatcgttcccggcaaaaatgtcaccatgcaccgcgaagctgacgttagcgatgaaagt taa

DBGET integrated database retrieval system