KEGG   Methanococcus maripaludis S2: MMP1426
Entry
MMP1426           CDS       T00164                                 

Symbol
dcd
Name
(GenBank) Bifunctional dCTP deaminase/dUTP diphosphatase
  KO
K09887  dCTP deaminase (dUMP-forming) [EC:3.5.4.30]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00240  Pyrimidine metabolism
mmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MMP1426 (dcd)
Enzymes [BR:mmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.30  dCTP deaminase (dUMP-forming)
     MMP1426 (dcd)
SSDB
Motif
Pfam: dUTPase DCD
Other DBs
NCBI-ProteinID: CAF30982
UniProt: Q6LXC6
LinkDB
Position
1398840..1399460
AA seq 206 aa
MILSDKDIFNYVTSKRVLIEPFNSKFVGPCSYDVTLGSEFIKYNEDVYDVKKTLNHSKFK
IENSVMVCPLNHHLDETIIKNYKEKYNVDCVVSGGLLGTTNEYVELPNDVCAQYQGRSSF
GRVFLQTHQTAGWIDSGFKGKITLEIVAYDKPVILYKNQRVGQLIFSKTLSPADIGYSDR
KCSKYAGQTSVMASLIKKDFETNEEE
NT seq 621 nt   +upstreamnt  +downstreamnt
atgatattaagtgataaagacatttttaattatgttacttcaaaaagagttttaattgag
cctttcaactcaaaattcgttggaccttgttcttatgacgttacccttggaagcgaattt
ataaaatacaacgaagacgtttacgatgttaaaaaaactctaaaccacagtaaatttaaa
attgaaaattccgttatggtgtgtcccctaaaccaccacttggatgaaacaataattaaa
aactataaagaaaaatacaatgtcgactgtgttgtgagtggaggacttttaggaaccact
aatgaatacgtagaacttccaaatgatgtttgtgcacagtaccagggtagaagcagtttt
ggaagggtatttttacaaacacaccaaaccgcaggctggattgattcaggatttaaagga
aaaataacgttagaaattgtagcttatgataaacctgtaattctttataaaaaccagaga
gtagggcagttaatatttagtaaaacactttcaccagcagatatcggatattcagataga
aaatgctcaaaatatgcaggacagacgtcagtaatggcatcacttattaaaaaagacttt
gaaactaatgaggaggaataa

DBGET integrated database retrieval system