KEGG   Janthinobacterium sp. Marseille: mma_1800
Entry
mma_1800          CDS       T00561                                 
Symbol
ptsN1
Name
(GenBank) PTS system, nitrogen regulatory IIA component
  KO
K02806  nitrogen PTS system EIIA component [EC:2.7.1.-]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:mms00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    mma_1800 (ptsN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mms02000]
    mma_1800 (ptsN1)
Transporters [BR:mms02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Nitrogen regulatory II component
    mma_1800 (ptsN1)
SSDB
Motif
Pfam: PTS_EIIA_2 Band_3_cyto
Other DBs
NCBI-ProteinID: ABR90273
LinkDB
Position
complement(2033154..2033615)
AA seq 153 aa
MNTFSQYLLPENIFLDLRAANKLQAFALIAGLLERNCHINRALVYQKLYERENMDSTGLG
SGVAIPHAQVAGIKQPIAAFVRLHAPLDFSAPDEQPVSELFVLLLPVRTTRDHLQILAEL
AGMLCDPQFRTGLGNAGDVSAVLQCLQKQTLAS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaataccttttctcaatacctgttgccggaaaatatttttctggacctgcgtgcggca
aataaactgcaggctttcgccttgatcgccggactgctggaacgcaattgccacatcaat
cgcgcactggtttatcaaaaattatacgagcgcgaaaacatggatagcaccggactcggt
agcggtgtggcgattccgcatgcgcaggtggcaggtatcaagcaaccgatagcggccttc
gtgcgtttgcatgcgccgcttgatttctccgcgcctgatgagcagccggtttccgaactg
tttgttttattgttgccagtcaggacgacgcgtgatcatttgcagatattggctgaactg
gcagggatgctatgcgatccgcaattccgcacgggccttgggaatgcaggcgatgtctct
gcggtattgcagtgtttgcagaagcaaacgcttgcatcttaa

DBGET integrated database retrieval system