Janthinobacterium sp. Marseille: mma_3271
Help
Entry
mma_3271 CDS
T00561
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
mms
Janthinobacterium sp. Marseille
Pathway
mms00190
Oxidative phosphorylation
mms01100
Metabolic pathways
mms02020
Two-component system
Module
mms_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
mms00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
mma_3271 (petA)
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
mma_3271 (petA)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
mma_3271 (petA)
Enzymes [BR:
mms01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
mma_3271 (petA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Rieske
Motif
Other DBs
NCBI-ProteinID:
ABR89245
LinkDB
All DBs
Position
complement(3645723..3646331)
Genome browser
AA seq
202 aa
AA seq
DB search
MSNEKQVDSGRRGLLVATCAAGGVAGLATTGVLVSTFQPSERAKAAGAPVEVDISSLAPG
EMKTVEWRGNPVWILKRTPEQVAALGKTDNELADPESARTQFSTTPEYALNEWRSRQKDL
LVVVGICPHLGCSPTAKFQTGAQPSLPDDWHGGFLCPCHGSTFDLAGRVYKNKPSPDNLQ
VPPYMFEGDTKLVIGKDEKGEA
NT seq
609 nt
NT seq
+upstream
nt +downstream
nt
atgagtaacgaaaagcaggtcgattccggtcggcgaggcttgctcgtcgccacatgtgcg
gcgggtggcgtagctggcttagccacaactggagtattagtctctacgtttcagccatcg
gagcgcgcaaaagccgctggtgcgcctgttgaagtcgatatttctagcctcgctcccggc
gagatgaagaccgtcgaatggcgcggtaatcccgtctggatcctcaaacgtacacccgaa
caggtggccgctttgggtaaaacagacaatgaactggccgatcctgagtcagcgcgtacg
caattctccaccaccccggaatacgccttgaatgaatggcgttcacgacaaaaagacctg
ttggtcgtggttggtatctgtcctcacctgggttgctcgccgaccgccaagttccagacc
ggtgcacagccatcgctgccggacgactggcacggcggcttcctgtgcccatgccacggt
tcgaccttcgatctggccggccgcgtttataaaaataaaccttcgccagacaatctgcag
gttccgccgtatatgtttgaaggcgacaccaaactggtcatcggtaaagatgagaaaggc
gaggcgtaa
DBGET
integrated database retrieval system