Methylomonas methanica: Metme_0340 Help Entry Metme_0340        CDS       T01511                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmt  Methylomonas methanica Pathway mmt01100   Metabolic pathways mmt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Metme_0340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Metme_0340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEF98787 UniProt:  G0A0L1 LinkDB All DBs Position complement(364918..365181) Genome browser AA seq 87 aa AA seqDB search MSDDLISQLKTLLIEGLRLEDIVPDDLSADEALFGGGLGLDSIDALEIGVMLDRQYGVKI TSGDERNNQIFASLRALADFVAENRTR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcagacgacttgatcagccaattaaaaaccttgctcatcgagggcctgcgcctggaa gatatcgttccggacgacctttccgcggacgaggcattgtttggcggcggactgggcctg gattccatcgatgcattggaaataggcgtgatgctggaccgtcaatacggcgtcaaaatt acctccggcgacgaacgcaacaaccaaatttttgcatccctgcgcgcactggcggatttc gtagctgaaaatcgcacccgttag

DBGET integrated database retrieval system