Mus musculus (house mouse): 100043318 Help Entry 100043318         CDS       T01002                                  Symbol Gng5c, Gm4356 Name (RefSeq) G protein subunit gamma 5C   KO K04542   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 Organism mmu  Mus musculus (house mouse) Pathway mmu04014   Ras signaling pathway mmu04062   Chemokine signaling pathway mmu04081   Hormone signaling mmu04082   Neuroactive ligand signaling mmu04151   PI3K-Akt signaling pathway mmu04371   Apelin signaling pathway mmu04713   Circadian entrainment mmu04723   Retrograde endocannabinoid signaling mmu04724   Glutamatergic synapse mmu04725   Cholinergic synapse mmu04726   Serotonergic synapse mmu04727   GABAergic synapse mmu04728   Dopaminergic synapse mmu04926   Relaxin signaling pathway mmu05032   Morphine addiction mmu05034   Alcoholism mmu05163   Human cytomegalovirus infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100043318 (Gng5c)    04371 Apelin signaling pathway     100043318 (Gng5c)    04151 PI3K-Akt signaling pathway     100043318 (Gng5c)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     100043318 (Gng5c)    04081 Hormone signaling     100043318 (Gng5c)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100043318 (Gng5c)   09152 Endocrine system    04926 Relaxin signaling pathway     100043318 (Gng5c)   09156 Nervous system    04724 Glutamatergic synapse     100043318 (Gng5c)    04727 GABAergic synapse     100043318 (Gng5c)    04725 Cholinergic synapse     100043318 (Gng5c)    04728 Dopaminergic synapse     100043318 (Gng5c)    04726 Serotonergic synapse     100043318 (Gng5c)    04723 Retrograde endocannabinoid signaling     100043318 (Gng5c)   09159 Environmental adaptation    04713 Circadian entrainment     100043318 (Gng5c)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100043318 (Gng5c)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100043318 (Gng5c)    05163 Human cytomegalovirus infection     100043318 (Gng5c)    05167 Kaposi sarcoma-associated herpesvirus infection     100043318 (Gng5c)   09165 Substance dependence    05032 Morphine addiction     100043318 (Gng5c)    05034 Alcoholism     100043318 (Gng5c)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     100043318 (Gng5c)    04031 GTP-binding proteins [BR:mmu04031]     100043318 (Gng5c) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100043318 (Gng5c) GTP-binding proteins [BR:mmu04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     100043318 (Gng5c) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  100043318 NCBI-ProteinID:  NP_001423242 MGI:  3782541 LinkDB All DBs Position 17:28945200..28945678 Genome browser AA seq 68 aa AA seqDB search MLGSSSVAAMKKVVQQLRLEAGLNRVKVSLAAAGLKQFCLQNAQHDPLLTGGSSSTNPFR PQKVCSFL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgttgggttcttctagcgttgccgccatgaagaaggtggttcagcagctccggctggag gccgggctgaaccgcgtgaaggtttccctggcagctgcaggcttgaagcagttctgtctg cagaatgctcaacatgaccctctgctgactggagggtcttcaagtacaaatcccttcaga ccccagaaagtctgctcctttttgtag

DBGET integrated database retrieval system