Mus musculus (house mouse): 100503710 Help Entry 100503710         CDS       T01002                                  Symbol Gng14, EG436049, Gm5741 Name (RefSeq) G protein subunit gamma 14   KO K04347   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Organism mmu  Mus musculus (house mouse) Pathway mmu04010   MAPK signaling pathway mmu04014   Ras signaling pathway mmu04062   Chemokine signaling pathway mmu04081   Hormone signaling mmu04082   Neuroactive ligand signaling mmu04151   PI3K-Akt signaling pathway mmu04371   Apelin signaling pathway mmu04713   Circadian entrainment mmu04723   Retrograde endocannabinoid signaling mmu04724   Glutamatergic synapse mmu04725   Cholinergic synapse mmu04726   Serotonergic synapse mmu04727   GABAergic synapse mmu04728   Dopaminergic synapse mmu04810   Regulation of actin cytoskeleton mmu04926   Relaxin signaling pathway mmu05032   Morphine addiction mmu05034   Alcoholism mmu05163   Human cytomegalovirus infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100503710 (Gng14)    04014 Ras signaling pathway     100503710 (Gng14)    04371 Apelin signaling pathway     100503710 (Gng14)    04151 PI3K-Akt signaling pathway     100503710 (Gng14)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     100503710 (Gng14)    04081 Hormone signaling     100503710 (Gng14)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100503710 (Gng14)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100503710 (Gng14)   09152 Endocrine system    04926 Relaxin signaling pathway     100503710 (Gng14)   09156 Nervous system    04724 Glutamatergic synapse     100503710 (Gng14)    04727 GABAergic synapse     100503710 (Gng14)    04725 Cholinergic synapse     100503710 (Gng14)    04728 Dopaminergic synapse     100503710 (Gng14)    04726 Serotonergic synapse     100503710 (Gng14)    04723 Retrograde endocannabinoid signaling     100503710 (Gng14)   09159 Environmental adaptation    04713 Circadian entrainment     100503710 (Gng14)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100503710 (Gng14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100503710 (Gng14)    05163 Human cytomegalovirus infection     100503710 (Gng14)    05167 Kaposi sarcoma-associated herpesvirus infection     100503710 (Gng14)   09165 Substance dependence    05032 Morphine addiction     100503710 (Gng14)    05034 Alcoholism     100503710 (Gng14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     100503710 (Gng14)    04031 GTP-binding proteins [BR:mmu04031]     100503710 (Gng14) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100503710 (Gng14)   Exosomal proteins of colorectal cancer cells    100503710 (Gng14) GTP-binding proteins [BR:mmu04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     100503710 (Gng14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  G-gamma MS_channel_3rd Motif Other DBs NCBI-GeneID:  100503710 NCBI-ProteinID:  NP_001182460 MGI:  3645690 Ensembl:  ENSMUSG00000095845 UniProt:  B2RVA4 LinkDB All DBs Position 8:complement(85794141..85794647) Genome browser AA seq 72 aa AA seqDB search MSSKVATGSDIGQARRAVEQLRMEAGINRIKVSKAATDLLQFCTEQAKSDPFLVGIPAAT NPFKEKKPCAIL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtctagcaaggtggccactggcagtgacatcggacaggcccgtcgggcagtggagcaa ctgcggatggaagcaggcatcaaccgcataaaggtatccaaggcagctacagatctgctg cagttctgcactgaacaggccaagagcgaccccttccttgtgggcatcccagctgccacc aaccctttcaaggaaaagaaaccctgtgctatcctatga

DBGET integrated database retrieval system