Mus musculus (house mouse): 102641752 Help Entry 102641752         CDS       T01002                                  Symbol Gm38574 Name (RefSeq) predicted gene, 38574   KO K10802   high mobility group protein B1 Organism mmu  Mus musculus (house mouse) Pathway mmu03410   Base excision repair mmu04140   Autophagy - animal mmu04217   Necroptosis mmu04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     102641752 (Gm38574)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102641752 (Gm38574)   09143 Cell growth and death    04217 Necroptosis     102641752 (Gm38574)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102641752 (Gm38574)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     102641752 (Gm38574)    03400 DNA repair and recombination proteins [BR:mmu03400]     102641752 (Gm38574)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     102641752 (Gm38574) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     102641752 (Gm38574) DNA repair and recombination proteins [BR:mmu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      102641752 (Gm38574)    MMR (mismatch excision repair)     Other MMR factors      102641752 (Gm38574) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102641752 (Gm38574) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 Motif Other DBs NCBI-GeneID:  102641752 NCBI-ProteinID:  XP_036010346 MGI:  5621459 Ensembl:  ENSMUSG00000110648 LinkDB All DBs Position 8:complement(127708376..127709031) Genome browser AA seq 179 aa AA seqDB search MGKEDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKC EDLAKADKARYVREMKTYIPLPKGETKKKFKDPNAPERPPSAFFLFCSEYRPKIKGEHPG LSIGDVAKKLGEMWTNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKSDTAKKGGGQS NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atgggcaaagaagatcctaagaagccgagaggcaaaatgtcctcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccggatgcttctgtcaacttctccgag ttctccaagaagtgctcagagaggtggaagaccatgtctgctaaagaaaaggggaaatgt gaagatctggcaaaggctgacaaggctcgttatgtaagagaaatgaaaacctacatcccc ctccccaaaggggagaccaaaaagaagttcaaggaccccaatgcacccgagaggcctcct tcggccttcttcttgttctgttctgagtaccgccccaaaatcaaaggcgagcatcctggc ttatccattggtgatgttgcaaagaaactaggagagatgtggaccaacactgcagcagat gacaagcagccctatgagaagaaagctgccaagctgaaggagaagtacgagaaggatatt gctgcctacagagctaaaggaaaatctgatacagcgaaaaaagggggtggtcaaagctga

DBGET integrated database retrieval system