KEGG   Mus musculus (house mouse): 108100
Entry
108100            CDS       T01002                                 
Symbol
Baiap2, IRSp53, R75030
Name
(RefSeq) brain-specific angiogenesis inhibitor 1-associated protein 2
  KO
K05627  BAI1-associated protein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04520  Adherens junction
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108100 (Baiap2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108100 (Baiap2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108100 (Baiap2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    108100 (Baiap2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   I-BAR proteins
    108100 (Baiap2)
SSDB
Motif
Pfam: IMD SH3_2 SH3_9 SH3_1 BAR RasGAP MazG Peptidase_Mx1
Other DBs
NCBI-GeneID: 108100
NCBI-ProteinID: NP_001032844
MGI: 2137336
Ensembl: ENSMUSG00000025372
UniProt: Q8BKX1 Q3UKP6
LinkDB
Position
11:119833762..119897608
AA seq 535 aa
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTFAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEETLKSFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPNKIPDRA
VQLMQQMANSNGSILPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQENVPVM
NGVAGPDSEDYNPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENK
TLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESE
KTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLALPPPDYGTSSRAFP
TQTAGTFKQRPYSVAVPAFSQGLDDYGARSVSRNPFANVHLKPTVTNDRSAPLLS
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgtcgctttcacgctcggaggagatgcaccggctcacggaaaatgtctacaagaccatc
atggagcagttcaaccccagcctccgcaacttcatcgccatgggcaagaactatgagaaa
gcactggcaggtgtcaccttcgctgccaaaggctatttcgatgctctggtaaagatgggg
gagctggccagcgagagccagggctctaaggaacttggggacgtcctcttccagatggct
gaggtgcaccggcagatccagaaccagttggaagagacgctgaagtcttttcacaatgag
ctgctcacgcagctggagcagaaagtagaactggactccaggtatctaagtgctgcactg
aagaaataccaaacggaacagaggagcaaaggggacgccctggacaagtgtcaggctgag
ctgaagaagctccgcaagaagagccaagggagtaagaaccctcagaagtactcagacaag
gagctgcagtacatcgatgccatcagcaataagcagggcgagctggagaactacgtgtct
gacggctacaagacagcactcactgaggagcgcaggaggttctgcttcctggtggaaaag
cagtgcgctgtggccaagaactctgctgcttaccattccaagggcaaggagttgctggcc
cagaagctgcctctgtggcagcaagcctgtgccgaccccaacaagatcccagaccgtgct
gtccagctgatgcaacagatggccaatagcaatggctccatccttccaagtgccctgtca
gcttccaagtccaacctggtcatctcagatcccattcctggagccaagcccttgccagtg
ccacctgagctggcaccatttgtggggcggatgtctgctcaggagaatgtacctgtcatg
aatggcgtcgcaggcccggacagcgaggactacaacccctgggctgaccgaaaggctgcc
cagcccaaatccctgtctcccccgcagtctcaaagcaagctgagcgactcgtactccaac
acactccccgtgcgcaagagcgtgacgccgaagaacagctatgccaccactgagaacaag
acactgccacgttcaagctccatggcagctggcctagaacgtaatggccgcatgcgggtc
aaggccattttctcccacgcggccggtgacaatagcactctgctgagcttcaaggagggc
gacctcatcacgctgctagtgcctgaggcccgtgacggctggcactatggggagagtgag
aagaccaagatgcggggctggttccccttctcctacacccgggtcctggacagtgacgga
agtgacagattgcatatgagcctgcagcagggcaagagcagcagcacaggcaacctccta
gacaaggatgacctggccctcccccctcctgactacggcacgtcctcccgggcattcccc
acccagacagccggcacattcaagcagagaccctacagcgtggccgttcctgccttctct
cagggtctggatgactacggggcacggtctgtgagcaggaatcccttcgccaacgtccat
ctgaaaccaacagtgaccaatgacagatcagcccctctgctcagctga

DBGET integrated database retrieval system