KEGG   Mus musculus (mouse): 11676Help
Entry
11676             CDS       T01002                                 

Gene name
Aldoc, AI847350, AU040929, Aldo3, Scrg2
Definition
(RefSeq) aldolase C, fructose-bisphosphate
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00030  Pentose phosphate pathway
mmu00051  Fructose and mannose metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11676 (Aldoc)
   00030 Pentose phosphate pathway
    11676 (Aldoc)
   00051 Fructose and mannose metabolism
    11676 (Aldoc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11676 (Aldoc)
   03036 Chromosome and associated proteins [BR:mmu03036]
    11676 (Aldoc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11676 (Aldoc)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     11676 (Aldoc)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    11676 (Aldoc)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    11676 (Aldoc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   11676 (Aldoc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 11676
NCBI-ProteinID: NP_001290352
MGI: 101863
Ensembl: ENSMUSG00000017390
Vega: OTTMUSG00000000108
UniProt: P05063
LinkDB All DBs
Position
11 B5; 11 46.74 cM
AA seq 363 aa AA seqDB search
MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTD
GETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTF
SYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRYEGSGDGGAAAQSLYIAN
HAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccccactcatacccagctctttctgctgagcagaagaaggagttgtcggatattgct
ctacggatcgtgacccccggcaagggcattctggctgcagatgagtccgtaggcagcatg
gccaaaaggctgagccaaattggggtggagaacactgaggagaatcgccggctgtaccgc
caggtcctattcagtgctgatgaccgtgtgaaaaagtgcattgggggggtcatcttcttc
catgagacactctaccagaaagatgacaatggtgtccccttcgtccgcaccatccaggat
aagggcattctcgtaggcatcaaggttgacaagggtgtagtgcctctagctgggaccgac
ggggaaaccaccactcaagggctggatgggctcttggaacgctgtgctcagtataagaag
gacggtgctgattttgccaaatggcgctgtgtactaaaaatcagtgatcgcacgccgtcg
gcactggccatattggagaatgccaacgtgctggcccgctatgccagcatctgccagcag
aatgggatcgtgcctattgtggagcctgagattctgcctgacggagaccatgacctcaaa
cgttgccagtatgttacagagaaggtcctggctgctgtatacaaggccctgagtgaccat
catgtatacctcgaagggactctgctcaagcccaatatggtgacccctggccatgcctgt
cccatcaagtatagcccagaagagatcgccatggcaactgtcactgccctgcgtcgtact
gtgcccccagctgtcccaggggtgactttcctgtctgggggtcagagtgaagaggaggct
tctctcaacctcaatgccatcaaccgctgcccacttccccggccctgggccctcaccttc
tcctatgggcgtgccctgcaggcatctgcactcaatgcctggagaggacaaagggataat
gctggggctgctactgaggagtttatcaagcgggcagagatgaacgggcttgcagcccag
ggcagatatgaaggcagtggagatggcggagcggcagcacagtccctctacatcgccaac
catgcctactga

DBGET integrated database retrieval system