Mus musculus (house mouse): 11840 Help Entry 11840             CDS       T01002                                  Symbol Arf1 Name (RefSeq) ARF GTPase 1   KO K07937   ADP-ribosylation factor 1/2 Organism mmu  Mus musculus (house mouse) Pathway mmu04072   Phospholipase D signaling pathway mmu04144   Endocytosis mmu05132   Salmonella infection mmu05134   Legionellosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     11840 (Arf1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     11840 (Arf1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     11840 (Arf1)    05134 Legionellosis     11840 (Arf1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     11840 (Arf1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     11840 (Arf1)    04031 GTP-binding proteins [BR:mmu04031]     11840 (Arf1) Membrane trafficking [BR:mmu04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     11840 (Arf1)   Arf GTPases and associated proteins    Arf GTPases     11840 (Arf1)  Endosome - Golgi transport     11840 (Arf1) Exosome [BR:mmu04147]  Exosomal proteins   Proteins found in most exosomes    11840 (Arf1) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     11840 (Arf1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M cobW Motif Other DBs NCBI-GeneID:  11840 NCBI-ProteinID:  NP_001123880 MGI:  99431 Ensembl:  ENSMUSG00000048076 UniProt:  P84078 Structure PDBPDBj LinkDB All DBs Position 11:complement(59102237..59119042) Genome browser AA seq 181 aa AA seqDB search MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggggaatatctttgcaaacctcttcaagggcctttttggcaaaaaagaaatgcgcatt ctcatggtgggcctggatgctgcagggaagacaacaattctatacaaacttaagctgggc gaaattgtgaccaccattcccaccattggtttcaatgtggagactgttgaatacaagaat atcagcttcaccgtgtgggatgtgggcggccaggacaagatccggccgctgtggcgccac tacttccagaacacccaaggcttgatcttcgtagtggacagcaatgacagagagcgtgtg aacgaggcccgtgaagagctcatgaggatgctagctgaagatgagctccgagatgctgtt ctcttggtgtttgccaacaagcaggacctccccaatgccatgaatgcggccgaaatcaca gacaagctggggctgcactctctacgccacaggaactggtacattcaggccacctgtgcc accagcggggacgggctctatgaaggactagattggctgtctaatcagctccggaaccag aagtga

DBGET integrated database retrieval system