Mus musculus (house mouse): 11842 Help Entry 11842             CDS       T01002                                  Symbol Arf3, 5430400P17Rik Name (RefSeq) ADP-ribosylation factor 3   KO K07938   ADP-ribosylation factor 3 Organism mmu  Mus musculus (house mouse) Pathway mmu04144   Endocytosis Brite KEGG Orthology (KO) [BR:mmu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     11842 (Arf3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     11842 (Arf3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     11842 (Arf3)    04031 GTP-binding proteins [BR:mmu04031]     11842 (Arf3) Membrane trafficking [BR:mmu04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     11842 (Arf3) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    11842 (Arf3)   Exosomal proteins of colorectal cancer cells    11842 (Arf3) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     11842 (Arf3) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M cobW Motif Other DBs NCBI-GeneID:  11842 NCBI-ProteinID:  NP_001342439 MGI:  99432 Ensembl:  ENSMUSG00000051853 UniProt:  P61205 Q3U344 LinkDB All DBs Position 15:complement(98635505..98660999) Genome browser AA seq 181 aa AA seqDB search MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atgggcaatatctttgggaaccttctgaagagcctaatcggcaagaaggagatgcgcatc ctgatggtgggcctggatgctgccgggaagaccaccatcctctacaagctgaaactcggg gagattgtcaccaccatcccgaccattgggtttaatgtggagacagtggaatataagaat atcagcttcacagtctgggacgtaggtggccaggacaagattcggcccctctggagacac tacttccagaacacccaaggcttgatatttgtggttgacagcaatgatcgggagcgagtg aacgaggcccgggaagagctgatgaggatgctggcggaggatgagctccgggatgctgtg ctccttgtgtttgcaaacaaacaggatttgccgaatgctatgaatgctgctgagatcaca gacaagctggggctgcactccctgcgtcaccgcaattggtacattcaggccacctgtgct accagcggggacgggctgtatgaaggcttggactggctggccaatcagctcaaaaacaag aagtga

DBGET integrated database retrieval system