Mus musculus (house mouse): 11843 Help Entry 11843             CDS       T01002                                  Symbol Arf4 Name (RefSeq) ARF GTPase 4   KO K07939   ADP-ribosylation factor 4 Organism mmu  Mus musculus (house mouse) Pathway mmu04144   Endocytosis Brite KEGG Orthology (KO) [BR:mmu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     11843 (Arf4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     11843 (Arf4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     11843 (Arf4)    04031 GTP-binding proteins [BR:mmu04031]     11843 (Arf4) Membrane trafficking [BR:mmu04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     11843 (Arf4) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    11843 (Arf4)   Exosomal proteins of other body fluids (saliva and urine)    11843 (Arf4)   Exosomal proteins of colorectal cancer cells    11843 (Arf4) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     11843 (Arf4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB Roc G-alpha Ras Gtr1_RagA MMR_HSR1 6PF2K Motif Other DBs NCBI-GeneID:  11843 NCBI-ProteinID:  NP_031505 MGI:  99433 Ensembl:  ENSMUSG00000021877 UniProt:  P61750 Q14BR4 LinkDB All DBs Position 14:26359289..26377997 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctctctcttctcgcgcctgttcggcaagaagcagatgcgcatt ttgatggttggattggatgctgctggcaagacgacaattctgtataaactgaaattaggg gaaatagtcaccaccattcctaccattggttttaatgtggaaacagtagaatataagaac atttgtttcacagtatgggatgttggtggtcaagataaaattaggcctctctggaggcat tacttccagaatacccagggtctcatttttgtggtagatagcaatgatcgtgaaagaatc caggaaggagcagctgtgctgcagaaaatgcttctggaagatgagctgcaggatgcagtg ctgctcctttttgcaaacaaacaggatctgccaaacgctatggccatcagtgagatgaca gacaagctaggtctgcagtctctccgaaacagaacatggtatgtccaagccacttgtgct acacaaggaactggtctgtatgagggactggattggctgtcaaatgaactttcaaaacgt taa

DBGET integrated database retrieval system