Mus musculus (house mouse): 11844 Help Entry 11844             CDS       T01002                                  Symbol Arf5 Name (RefSeq) ARF GTPase 5   KO K07940   ADP-ribosylation factor 5 Organism mmu  Mus musculus (house mouse) Pathway mmu04144   Endocytosis Brite KEGG Orthology (KO) [BR:mmu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     11844 (Arf5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     11844 (Arf5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     11844 (Arf5)    04031 GTP-binding proteins [BR:mmu04031]     11844 (Arf5) Membrane trafficking [BR:mmu04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     11844 (Arf5) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    11844 (Arf5)   Exosomal proteins of colorectal cancer cells    11844 (Arf5) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     11844 (Arf5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB G-alpha Ras Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K DUF5675 Motif Other DBs NCBI-GeneID:  11844 NCBI-ProteinID:  NP_031506 MGI:  99434 Ensembl:  ENSMUSG00000020440 UniProt:  P84084 LinkDB All DBs Position 6:28423603..28426601 Genome browser AA seq 180 aa AA seqDB search MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAV LLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcacggtgtccgcgctcttttcgcggatcttcgggaagaagcagatgcggatc cttatggttggcttggatgcggctggcaagactaccatcctgtacaaactgaagttgggg gagattgtcaccaccatccccactataggcttcaatgtggaaacagtggaatataagaac atctgtttcacagtgtgggatgttggaggccaggataagattcggcctctgtggcggcac tacttccagaacactcagggcctcatctttgtggtagacagcaacgaccgggagcgggtc caggagtctgctgatgaactccagaagatgctgcaggaggatgagctccgggatgcggtg ctgctggtgtttgccaacaagcaggacatgcccaatgccatgcccgtgagcgagctgact gacaagctgggccttcagcacctgcgtagccgcacgtggtacgtccaggccacctgtgcc acccaaggcacaggcctgtatgatgggctggactggctgtcccacgagctgtcaaagcgc tag

DBGET integrated database retrieval system