KEGG   Mus musculus (mouse): 11883Help
Entry
11883             CDS       T01002                                 

Gene name
Arsa, AS-A, ASA, AW212749, As-2, As2, TISP73
Definition
(RefSeq) arylsulfatase A
  KO
K01134  arylsulfatase A [EC:3.1.6.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    11883 (Arsa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11883 (Arsa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.8  cerebroside-sulfatase
     11883 (Arsa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfatase Sulfatase_C Phosphodiest DUF1501
Motif
Other DBs
NCBI-GeneID: 11883
NCBI-ProteinID: NP_033843
MGI: 88077
Ensembl: ENSMUSG00000022620
Vega: OTTMUSG00000035225
UniProt: P50428
LinkDB All DBs
Position
15; 15 E3
AA seq 506 aa AA seqDB search
MALGTLFLALAAGLSTASPPNILLIFADDLGYGDLGSYGHPSSTTPNLDQLAEGGLRFTD
FYVPVSLCTPSRAALLTGRLPVRSGMYPGVLGPSSQGGLPLEEVTLAEVLAARGYLTGMA
GKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPDIPCKGGCDQGLVPIPL
LANLTVEAQPPWLPGLEARYVSFSRDLMADAQRQGRPFFLYYASHHTHYPQFSGQSFTKR
SGRGPFGDSLMELDGAVGALMTTVGDLGLLEETLVIFTADNGPELMRMSNGGCSGLLRCG
KGTTFEGGVREPALVYWPGHITPGVTHELASSLDLLPTLAALTGAPLPNVTLDGVDISPL
LLGTGKSPRKSVFFYPPYPDEIHGVFAVRNGKYKAHFFTQGSAHSDTTSDPACHAANRLT
AHEPPLLYDLSQDPGENYNVLESIEGVSPEALQALKHIQLLKAQYDAAMTFGPSQIAKGE
DPALQICCQPSCTPHPVCCHCPGSQS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggccctggggaccctctttttggcattggctgcaggcctgagcactgccagcccacct
aacatcctgctgatctttgcggatgacctgggctatggggacctcggctcctatgggcac
cccagttctaccacccctaacctggatcagttggctgaaggtggactacggttcacagat
ttctatgtgcctgtgtctctgtgcacgccatctcgggccgccctcctgactggccggctc
ccagttcgatcaggcatgtaccctggagttctggggcccagttcccaagggggcttgccc
ttggaggaggtgactttagccgaagtcctggctgctcgaggctaccttacagggatggct
ggcaagtggcatcttggagtggggccagagggggccttcctgcccccgcatcagggcttc
caccgattcctgggcatcccatattcccatgaccagggtccctgtcagaacctaacgtgc
ttcccaccagacatcccctgcaaaggtggctgtgaccaaggccttgttcccatcccacta
ctggccaacctgacagtggaggcccagcccccttggctgcctggactggaggcccggtat
gtgtctttctcccgagacctcatggctgatgcccagcgccagggccgaccgttcttcctg
tactacgcttcccaccacactcactaccctcagttcagtggacaaagcttcaccaagcgc
tcaggccgtgggccatttggggactccttgatggagctggatggagctgtaggggccttg
atgacaactgtgggggacctcggtctgctggaagagacactagtcatcttcactgcagat
aacggtcctgagttgatgcgcatgtccaatggcggctgctctggcctcttgagatgtgga
aaaggaacaacttttgaaggtggcgtccgagagcctgccttggtctactggccaggtcac
attactcctggtgtaacccatgagctggccagctctctggacctgctgcccaccctggca
gccctgaccggggctccgctgcccaacgtcaccttggatggtgttgacatcagccccttg
ctgctaggcacaggcaagagcccacggaagtctgtcttcttctacccgccctacccagac
gagatccatggggtctttgctgttcggaatgggaaatacaaggctcatttcttcacccag
ggctccgcccacagtgacaccacttcagatcctgcctgtcatgctgccaaccgtctgacg
gctcatgagcccccactgctctacgacttatctcaggaccctggggagaactacaatgtt
ttggaaagtatagagggggtctccccagaagccctccaggctttgaaacacatccaactc
ctcaaggcccagtacgatgcagccatgacctttggccccagccagatagccaagggcgag
gaccctgccctacagatctgctgtcagccgagctgcactccccaccctgtctgctgccac
tgcccaggctcccagtcctga

DBGET integrated database retrieval system