KEGG   Mus musculus (house mouse): 12051
Entry
12051             CDS       T01002                                 
Symbol
Bcl3, AI528691, Bcl-3
Name
(RefSeq) B cell leukemia/lymphoma 3
  KO
K09258  B-cell CLL/lymphoma 3 protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12051 (Bcl3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    12051 (Bcl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12051 (Bcl3)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12051 (Bcl3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    12051 (Bcl3)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   12051 (Bcl3)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 12051
NCBI-ProteinID: NP_291079
MGI: 88140
Ensembl: ENSMUSG00000053175
UniProt: Q9Z2F6
LinkDB
Position
7:complement(19542387..19556691)
AA seq 448 aa
MPRCPAGAMDEGPVDLRTRPKGTPGAALPLRKRPLRPASPEPATTRSPAGPLDALRSGCD
VPVVPGPPHCVARPEALYYQGPLMPIYSTPTMAPHFPLLNLPTHPYSMICPMEHPLSADI
AMATRVDEDGDTPLHIAVVQNNIAAVYRILSLFKLGSREVDVHNNLRQTPLHLAVITTLP
DMVRLLVTAGASPMALDRHGQTAIHLACEHRSPSCLQALLDSATSGSVDLEVRNYEGLTA
LHVAVNTGCQEAVLLLLERGADIDAVDIKSGRSPLIHAVENNSLNMVQLLLLHGANVNAQ
MYSGSSALHSASGRGLLPLVRTLVRSGADSGLKNCHNDTPLMVARSRRVIDILRGKASRA
ASGSQPEPSPDQSATNSPESSSRLSSNGLQSSPSSSPSLSPPKDAPGFPATPQNFFLPTT
STPAFLPFPGVLRGPGRPVPPSPAPGSS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgccccgatgccccgcgggggccatggacgaggggcccgtggacctgcgcacccggccc
aagggcaccccgggcgccgcgctgccactccgcaaacgcccgctgcgccccgcgtcccca
gagcccgcaaccacgcgcagccccgctggacccctggacgccctgcgcagcggctgcgac
gtcccggttgtccctgggcccccccactgtgtggccaggccggaggccctttactaccag
ggacctttgatgcccatttactctaccccgacgatggccccccactttccgctgctgaac
ctgcctactcacccctactccatgatatgccccatggaacaccccctttcagctgatatt
gccatggccactcgggtggatgaggatggagacacgcctctccacatcgctgtggtccag
aataacatagccgctgtctaccgaatactcagccttttcaagcttgggagccgcgaagta
gacgtccataacaacctgcggcagaccccgctccacctggctgtcatcaccacattacca
gacatggtccggctcttggtgacagctggtgccagccccatggccctggatcgtcacggc
cagactgcaattcacctggcatgcgagcaccgcagccccagctgcctgcaggccctgctg
gacagcgcaacctcaggctccgtggacctggaggttcgcaattatgaagggctcactgcc
ctgcacgtggccgtgaacaccgggtgccaggaggctgttctgctgctcctggagcgtggc
gcggacatcgatgcagtggatatcaagagcggccgctccccactcatccacgccgtggag
aacaacagcctgaacatggtgcaactcctgctgctgcacggcgccaacgtgaacgctcag
atgtattctggcagctcggctctgcattctgcgtctggccgcgggcttctgcctctggtg
cgcacgctggtgcgcagcggggctgacagcggcctcaagaactgtcacaatgacacacct
ctcatggtggcgcgcagccgcagggtcattgatatcttaagggggaaggcctctcgggct
gcttcagggtcacagcctgagccatccccagaccaaagtgccaccaactcccccgagagc
agcagtcgtctcagctccaatggcctccagtcctcgccaagctcctcaccctcgctgtct
cccccgaaagatgctcctggcttccccgcgactccccaaaactttttccttcccacaaca
tctacacctgccttcctgcccttcccaggagtcctccgaggccctggccggcccgtaccc
ccttccccagctccaggaagcagctga

DBGET integrated database retrieval system