KEGG   Mus musculus (house mouse): 12159
Entry
12159             CDS       T01002                                 
Symbol
Bmp4, Bmp-4, Bmp2b, Bmp2b-1, Bmp2b1
Name
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04919  Thyroid hormone signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12159 (Bmp4)
   04390 Hippo signaling pathway
    12159 (Bmp4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12159 (Bmp4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12159 (Bmp4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    12159 (Bmp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12159 (Bmp4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    12159 (Bmp4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12159 (Bmp4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12159 (Bmp4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12159 (Bmp4)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   12159 (Bmp4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Morphogens
   12159 (Bmp4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 12159
NCBI-ProteinID: NP_001303289
MGI: 88180
Ensembl: ENSMUSG00000021835
UniProt: P21275 Q3ULR1
LinkDB
Position
14:complement(46620982..46628126)
AA seq 408 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRS
FHHEEHLENIPGTSESSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRIN
IYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVT
HLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQR
SRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagaccgggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctacagatgtttgggctgcgccgccgtccgcagcctagcaagagcgccgtcattccg
gattacatgagggatctttaccggctccagtctggggaggaggaggaggaagagcagagc
cagggaaccgggcttgagtacccggagcgtcccgccagccgagccaacactgtgaggagt
ttccatcacgaagaacatctggagaacatcccagggaccagtgagagctctgcttttcgt
ttcctcttcaacctcagcagcatcccagagaatgaggtgatctcctcggcagagctccgg
ctctttcgggagcaggtggaccagggccctgactgggaacagggcttccaccgtataaac
atttatgaggttatgaagcccccagcagaaatggttcctggacacctcatcacacgacta
ctggacaccagactagtccatcacaatgtgacacggtgggaaactttcgatgtgagccct
gcagtccttcgctggacccgggaaaagcaacccaattatgggctggccattgaggtgact
cacctccaccagacacggacccaccagggccagcacgtcagaatcagccgatcgttacct
caagggagtggagattgggcccaactccggcccctcctggtcacttttggccatgatggc
cggggccataccttgacccgcagaagggccaaacgtagtcccaagcatcacccacagcgg
tccaggaagaagaataagaactgccgtcgccattcactatacgtggacttcagtgacgtg
ggctggaatgattggattgtggccccacccggctaccaggccttctactgccacggggac
tgtccctttccactggctgatcacctcaactcaaccaaccatgccattgtgcagacccta
gtcaactctgttaattctagtatccctaaggcctgttgtgtccccactgaactgagtgcc
atttccatgttgtacctggatgagtatgacaaggtggtgttgaaaaattatcaggagatg
gtggtagaggggtgtggatgccgctga

DBGET integrated database retrieval system