KEGG   Mus musculus (mouse): 12401Help
Entry
12401             CDS       T01002                                 

Gene name
Serpina6, Cbg
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade A, member 6
  KO
K04525  serpin peptidase inhibitor, clade A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    12401 (Serpina6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin PaaA_PaaC
Motif
Other DBs
NCBI-GeneID: 12401
NCBI-ProteinID: NP_031644
MGI: 88278
Ensembl: ENSMUSG00000060807
Vega: OTTMUSG00000027668
UniProt: Q06770 Q3UKW1
LinkDB All DBs
Position
12 E; 12 52.98 cM
AA seq 397 aa AA seqDB search
MSLALYTCLFWLCTSGLWTTQAVTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLI
SPVSISMALAMLSLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNM
GNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVVS
DLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRDSA
IPCQMVQMNYVGNGTTFIILPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMS
DTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLTVLHKAMLQLDEGNVLPAATNGPPV
HLPSESFTLKYNRPFIFLAFDKYTWSSLMMSQVMNPA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgccctgtatacctgtctcttctggctctgcaccagtggcctctggaccacc
caggctgtcactgatgaggattcaagttctcaccgagacctggctcccaccaatgttgac
tttgccttcaacttgtacaaacgcctagtggccctgaattctgacaagaataccttaatc
tccccagtgagcatctccatggccctggccatgctgtccctaagcaccaggggctccacc
cagtatctcgagaacctgggcttcaacatgtcaaagatgtctgaagctgagatccaccag
ggtttccagtacctcaattcccttctccagcagtctgacactggcttggagatgaacatg
ggcaatgtcatgttcctcctccagaacctaaagctgaaagactcattcttagcagacacc
aaacactattatgagtcagaggccttgaccatcccttccaaggactggactaaagccggc
gaacagatcaacaatcatgtgaagaataagacacaggggaaaattgagcatgtggtctca
gacctggatagttcagccaccctcatcctgatcaactacatcttcctcaaaggaatatgg
aaacttcccttcagcccagaaaatactagagaggaggacttctatgtgaatgagacaagc
acagtgaaggtgcccatgatggtccagtcaggcaacattagttactttcgtgattcggcg
atcccctgccagatggtacagatgaattatgtgggaaatggaactaccttcatcattctt
ccagaccagggccagatggacactgtcgtcgctgcacttaatcgggacacaattgatagg
tggggcaagcttatgattccaaggcagatgaacctgtacatccccaaattctccatgtct
gatacctatgaccttcaagatgtgctggcagatgtgggcattaaggatttgttcaccaac
caatctgatttcgcagacaccaccaaagacactcccttgacattaacggtactccacaag
gccatgctgcaactggatgaagggaatgtgctgcctgctgccaccaatggccctcctgta
cacctgccctccgaatcattcaccctcaagtacaacaggcccttcatcttcctggccttt
gacaagtacacatggagcagcctgatgatgagccaagtcatgaatccagcctaa

DBGET integrated database retrieval system