Mus musculus (house mouse): 12502 Help Entry 12502             CDS       T01002                                  Symbol Cd3g, Ctg-3, Ctg3, T3g Name (RefSeq) CD3 antigen, gamma polypeptide   KO K06452   T-cell surface glycoprotein CD3 gamma chain Organism mmu  Mus musculus (house mouse) Pathway mmu04640   Hematopoietic cell lineage mmu04658   Th1 and Th2 cell differentiation mmu04659   Th17 cell differentiation mmu04660   T cell receptor signaling pathway mmu05142   Chagas disease mmu05162   Measles mmu05166   Human T-cell leukemia virus 1 infection mmu05169   Epstein-Barr virus infection mmu05170   Human immunodeficiency virus 1 infection mmu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mmu00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     12502 (Cd3g)    04660 T cell receptor signaling pathway     12502 (Cd3g)    04658 Th1 and Th2 cell differentiation     12502 (Cd3g)    04659 Th17 cell differentiation     12502 (Cd3g)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     12502 (Cd3g)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     12502 (Cd3g)    05170 Human immunodeficiency virus 1 infection     12502 (Cd3g)    05162 Measles     12502 (Cd3g)    05169 Epstein-Barr virus infection     12502 (Cd3g)   09174 Infectious disease: parasitic    05142 Chagas disease     12502 (Cd3g)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:mmu04090]     12502 (Cd3g) CD molecules [BR:mmu04090]  Proteins   12502 (Cd3g) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ig_4 Ig_5 ITAM Ig_3 V-set_CD47 Ig_2 Motif Other DBs NCBI-GeneID:  12502 NCBI-ProteinID:  NP_033980 MGI:  88333 Ensembl:  ENSMUSG00000002033 UniProt:  P11942 Q3U4Y3 Structure PDBPDBj LinkDB All DBs Position 9:complement(44880870..44891729) Genome browser AA seq 182 aa AA seqDB search MEQRKGLAGLFLVISLLQGTVAQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGS IISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTISGFIF AEVISIFFLALGVYLIAGQDGVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLR KK NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atggagcagaggaagggtctggctggcctcttcctggtgatctctcttcttcaaggcact gtagcccagacaaataaagcaaagaatttggtacaagtggatggcagccgaggagacggt tctgtacttctgacttgtggcttgactgacaagactatcaagtggcttaaagacgggagc ataataagtcctctaaatgcaactaaaaacacatggaatctgggcaacaatgccaaagac cctcgaggcacgtatcagtgtcaaggagcaaaggagacatcaaaccccctgcaagtgtat tacagaatgtgtgaaaactgcattgagctaaacataggcaccatatccggctttatcttc gctgaggtcatcagcatcttcttccttgctcttggtgtatatctcattgcgggacaggat ggagttcgccagtcaagagcttcagacaagcagactctgttgcaaaatgaacagctgtac cagcccctcaaggaccgggaatatgaccagtacagccatctccaaggaaaccaactgagg aagaagtga

DBGET integrated database retrieval system