Mus musculus (house mouse): 12540 Help Entry 12540             CDS       T01002                                  Symbol Cdc42 Name (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism mmu  Mus musculus (house mouse) Pathway mmu04010   MAPK signaling pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04062   Chemokine signaling pathway mmu04144   Endocytosis mmu04360   Axon guidance mmu04370   VEGF signaling pathway mmu04510   Focal adhesion mmu04520   Adherens junction mmu04530   Tight junction mmu04660   T cell receptor signaling pathway mmu04666   Fc gamma R-mediated phagocytosis mmu04670   Leukocyte transendothelial migration mmu04722   Neurotrophin signaling pathway mmu04810   Regulation of actin cytoskeleton mmu04912   GnRH signaling pathway mmu04932   Non-alcoholic fatty liver disease mmu04933   AGE-RAGE signaling pathway in diabetic complications mmu05100   Bacterial invasion of epithelial cells mmu05132   Salmonella infection mmu05135   Yersinia infection mmu05165   Human papillomavirus infection mmu05200   Pathways in cancer mmu05203   Viral carcinogenesis mmu05205   Proteoglycans in cancer mmu05211   Renal cell carcinoma mmu05212   Pancreatic cancer mmu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     12540 (Cdc42)    04014 Ras signaling pathway     12540 (Cdc42)    04015 Rap1 signaling pathway     12540 (Cdc42)    04370 VEGF signaling pathway     12540 (Cdc42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     12540 (Cdc42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     12540 (Cdc42)    04520 Adherens junction     12540 (Cdc42)    04530 Tight junction     12540 (Cdc42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     12540 (Cdc42)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     12540 (Cdc42)    04666 Fc gamma R-mediated phagocytosis     12540 (Cdc42)    04670 Leukocyte transendothelial migration     12540 (Cdc42)    04062 Chemokine signaling pathway     12540 (Cdc42)   09152 Endocrine system    04912 GnRH signaling pathway     12540 (Cdc42)   09156 Nervous system    04722 Neurotrophin signaling pathway     12540 (Cdc42)   09158 Development and regeneration    04360 Axon guidance     12540 (Cdc42)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     12540 (Cdc42)    05205 Proteoglycans in cancer     12540 (Cdc42)    05203 Viral carcinogenesis     12540 (Cdc42)   09162 Cancer: specific types    05212 Pancreatic cancer     12540 (Cdc42)    05211 Renal cell carcinoma     12540 (Cdc42)   09172 Infectious disease: viral    05165 Human papillomavirus infection     12540 (Cdc42)   09171 Infectious disease: bacterial    05132 Salmonella infection     12540 (Cdc42)    05135 Yersinia infection     12540 (Cdc42)    05100 Bacterial invasion of epithelial cells     12540 (Cdc42)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     12540 (Cdc42)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     12540 (Cdc42)    04933 AGE-RAGE signaling pathway in diabetic complications     12540 (Cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     12540 (Cdc42)    03036 Chromosome and associated proteins [BR:mmu03036]     12540 (Cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     12540 (Cdc42)    04031 GTP-binding proteins [BR:mmu04031]     12540 (Cdc42) Membrane trafficking [BR:mmu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     12540 (Cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     12540 (Cdc42)   Macropinocytosis    Ras GTPases     12540 (Cdc42) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     12540 (Cdc42) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of microglial cells    12540 (Cdc42)   Exosomal proteins of breast milk    12540 (Cdc42) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     12540 (Cdc42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  12540 NCBI-ProteinID:  NP_001230698 MGI:  106211 Ensembl:  ENSMUSG00000006699 UniProt:  P60766 Structure PDB LinkDB All DBs Position 4:complement(137047007..137085070) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPP ETQPKRKCCIF NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaattaagtgtgttgttgttggtgatggtgctgttggtaaaacatgtctcctg atatcctacacaacaaacaaattcccatcggaatatgtaccaactgtttttgacaactat gcagtcacagttatgattggtggagagccatacactcttggactttttgatactgcaggg caagaggattatgacagactacgaccgctaagttatccacagacagatgtttttctagta tgtttctcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga gatgacccctctactattgagaaacttgccaagaacaaacagaagcctattactccagag actgctgaaaagctggcgcgggatctgaaggctgtcaagtatgtggagtgctctgccctc acacagagaggtctgaagaatgtgtttgatgaggctatcctagctgccctcgagcctccg gaaactcaacccaaaaggaagtgctgtatattctaa

DBGET integrated database retrieval system