KEGG   Mus musculus (house mouse): 12544
Entry
12544             CDS       T01002                                 
Symbol
Cdc45, Cdc45l
Name
(RefSeq) cell division cycle 45
  KO
K06628  cell division control protein 45
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12544 (Cdc45)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12544 (Cdc45)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    12544 (Cdc45)
SSDB
Motif
Pfam: CDC45
Other DBs
NCBI-GeneID: 12544
NCBI-ProteinID: NP_033992
MGI: 1338073
Ensembl: ENSMUSG00000000028
UniProt: Q9Z1X9 Q3UI99
LinkDB
Position
16:complement(18599197..18632371)
AA seq 566 aa
MFVTDFRKEFYETVHNQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELET
AYLEHKEQFSYFILINCGANVDLLDILQPDEDSIFFVCDTHRPVNVVNVYNDTQIKLLIK
QEDDLEVPAYDDIFRDEAEDEDLSDSDGDGSEPSEKRTRLEEEIVERNRKRRQRREWEAR
RKDILFDYEQYEYYGTSSAMVMFDLAWMMSKDLNDMLWWAIVGLTDQWVHDKITQMKYVT
DVGILQRHVSRHNHRNEAEENMLSVDCTRISFEYDLCLVLYQHWSLHESLYNTSYTAARF
KLWSVHGQKRLQEFLADMGLPLKQVKQKFQSMDVSLKGNLREMIEESANKFGMKDMRVQT
FSIQFGFKHKFLASDVVFATMSLMESPEKDGSGTDHFIQALDSLSRSNLDKLYLGLELAK
KHLQATQQTIASCLCTNLVTSQGPFLYCSLMEGTPDVTLFSKPASLSLLSRHLLKSFVYS
TKNRRCKLLPLVMAAPLSVEQGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRTLHN
YFDLSVIELKAEDRSKFLDALVSLLS
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgttcgtgaccgatttccgcaaggagttctacgagacggtccacaaccagagggtcctt
ctctttgtggcctcggacgtggatgccttgtgtgcttgcaagatcctccaggccctgttt
cagtgtgaccacgtccagtatacgctggttccggtttctgggtggcaagaacttgaaact
gcatatcttgaacataaagagcagttctcctatttcatcctcataaactgtggagccaac
gtggacctgttggatatccttcagcctgatgaagacagtatattttttgtgtgtgatacc
cacaggccagtgaacgttgtgaatgtgtacaatgacactcagatcaaattgcttattaaa
caagaggatgaccttgaggttcctgcctacgacgacatctttagagatgaagcagaggat
gaagatctttcagacagtgacggtgatgggtcagagccttcagagaagcgcacacggtta
gaagaggagatagtggagcgaaacaggaagaggaggcagcgcagggagtgggaggcccga
aggaaagacatcctctttgactacgagcagtatgaatattatgggacatcgtcggccatg
gtgatgtttgacctggcgtggatgatgtccaaggacctgaatgacatgctgtggtgggcc
attgttggactgacagaccagtgggtgcatgacaagatcactcaaatgaagtacgtgact
gatgttggcatcctgcagcgtcatgtgtcccgtcataaccaccgaaacgaggcggaggag
aacatgctctctgtagactgcacccggatctccttcgagtatgacctctgcctggtactg
tatcagcactggtccctccatgaaagcctgtacaacaccagctacacagcagccaggttt
aagctctggtctgtgcatgggcagaaacgactccaggagttccttgcagacatggggctt
cccctgaagcaagtcaagcagaaatttcagtccatggacgtttccttgaaggggaatctg
cgagaaatgattgaagaatctgcaaataaatttgggatgaaggacatgcgtgtacagact
ttcagcattcagtttgggttcaagcataaattcctggccagtgatgtcgtctttgccacc
atgtctctaatggagagtcctgagaaggatggctcagggacagaccacttcatccaggct
ctcgatagcctctccaggagtaacctggacaagctataccttggtctagagctcgccaag
aagcacctccaagccacacaacagaccatcgccagctgtctctgtaccaacctcgtcact
tcccagggcccttttctctactgctcactcatggagggcactccagatgtcaccctgttt
tccaagccagcatccttgagtctgctcagcagacatctgctcaagtcctttgtgtactcg
acaaagaatcgacgatgcaagctgctgcccctggtgatggctgccccgctgagcgtggaa
cagggcacagtgaccgtggtgggcatccccccagagactgatagctcggatagaaagaac
ttttttggtcgggcttttgagaaggcagcagaaagcaccagctctcggactctacacaat
tactttgacctctcagtaattgagctgaaggctgaggaccggagcaagttcctggacgct
cttgtgtcactgctgtcctga

DBGET integrated database retrieval system