KEGG   Mus musculus (house mouse): 12555
Entry
12555             CDS       T01002                                 
Symbol
Cdh15, AI323380, Cdh14, Mcad
Name
(RefSeq) cadherin 15
  KO
K06809  cadherin 15, M-cadherin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12555 (Cdh15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    12555 (Cdh15)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   12555 (Cdh15)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR RET_CLD1
Other DBs
NCBI-GeneID: 12555
NCBI-ProteinID: NP_031688
MGI: 106672
Ensembl: ENSMUSG00000031962
UniProt: P33146
LinkDB
Position
8:123575113..123594136
AA seq 784 aa
MGSALLLALGLLAQSLGLSWAVPEPKPSTLYPWRRASAPGRVRRAWVIPPISVSENHKRL
PYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRNVFSIDKFTGRVYLNATLDREKTDRFRLR
AFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQDVFRGRILEGAIPGTFVTRAEATDADD
PETDNAALRFSILEQGSPEFFSIDEHTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLT
ATASAIISIDDINDNAPEFTKDEFFMEAAEAVSGVDVGRLEVEDKDLPGSPNWVARFTIL
EGDPDGQFKIYTDPKTNEGVLSVVKPLDYESREQYELRVSVQNEAPLQAAAPRARRGQTR
VSVWVQDTNEAPVFPENPLRTSIAEGAPPGTSVATFSARDPDTEQLQRISYSKDYDPEDW
LQVDGATGRIQTQRVLSPASPFLKDGWYRAIILALDNAIPPSTATGTLSIEILEVNDHAP
ALALPPSGSLCSEPDQGPGLLLGATDEDLPPHGAPFHFQLNPRVPDLGRNWSVSQINVSH
ARLRLRHQVSEGLHRLSLLLQDSGEPPQQREQTLNVTVCRCGSDGTCLPGAAALRGGGVG
VSLGALVIVLASTVVLLVLILLAALRTRFRGHSRGKSLLHGLQEDLRDNILNYDEQGGGE
EDQDAYDINQLRHPVEPRATSRSLGRPPLRRDAPFSYVPQPHRVLPTSPSDIANFISDGL
EAADSDPSVPPYDTALIYDYEGDGSVAGTLSSILSSLGDEDQDYDYLRDWGPRFARLADM
YGHQ
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgggttctgctctgctcctcgccctcgggctgcttgcccagagccttggcctgtcctgg
gcagtccctgagcccaaacccagcaccctgtacccctggcgccgggcatcagccccaggc
cgtgtgcggagagcctgggtcatcccacccattagtgtgtctgagaaccacaaacgcctc
ccctacccacttgtgcagatcaagtctgacaaacagcagctaggcagtgtcatctacagc
atccagggtcccggagtggatgaggagccccgaaatgtcttctccatcgacaagttcacc
gggagggtgtacctcaatgccacgctggaccgcgagaagacggaccgcttcaggctaagg
gcctttgccttggacttgggtggctctaccctggaggaccccacggacctggagatcgtt
gtggtggatcaaaatgacaaccggccagccttcctacaggatgtgttcagaggccgcatc
ctggagggtgccatcccaggcaccttcgtcaccagggctgaggccacagatgccgacgac
ccagagacagacaatgcagccctcaggttctccatcctggagcagggcagccctgagttc
ttcagcatcgacgagcacacgggagagatccgcacggtgcaagtggggctggaccgtgag
gtggtggctgtgtataatctgaccttgcaagtggcagacatgtcgggagacggactcact
gccacagcctcggccatcatctccatagatgacatcaacgacaatgcccccgagttcacc
aaggatgagttctttatggaggctgcagaggctgtcagtggagtggacgtgggacggctc
gaggtggaagacaaggacctgcctggttcccccaactgggtggccaggttcaccatcctt
gaaggtgatcctgatgggcagttcaagatctacacagaccctaagaccaatgaaggtgtg
ctgtccgtggtcaagcccctggactatgagagccgtgagcagtatgagctcagagtgtct
gtacaaaacgaggccccgctgcaggcagctgcccctcgggctcggcggggccagaccagg
gtcagcgtgtgggttcaggacaccaacgaagctccagtgtttccagagaacccactgagg
acgagcatagctgaaggagcccccccaggcacctctgtggccaccttctctgccagagac
cctgacacagaacagctgcagagaatcagctactccaaagactacgacccagaagactgg
ctgcaagtggacggggccacaggcaggatccagacccagcgagtgctgagccctgcttca
ccctttttgaaggacggctggtacagagccatcatcctagccctggacaatgccattcct
cctagcacagccacaggcaccctgtccatcgagatcctagaagtcaacgaccatgcccct
gcactggctcttcctccatctggcagcctgtgcagtgaaccagaccagggccctggcctc
ctcttgggtgccacggatgaggacctgcccccacacggggcccctttccacttccagctg
aaccccagagtaccagatctgggccggaactggagcgtcagccagattaacgtgagccat
gcacgcttgcggctccgacatcaggtctccgagggcctgcatcgcctgagcctgctactc
caggactctggggagccaccccagcagcgagagcaaacgctgaacgtcaccgtgtgtcgc
tgtgggtcggatggcacttgcctgcccggggctgccgcgcttcgaggaggaggtgtaggc
gtcagcttgggggcactggtcattgtgctggccagcaccgtggtcttactagttctcatc
ctgcttgccgcgctccgcacacggttccgggggcattcccggggcaagagtctgttgcat
ggcctacaagaggaccttcgggacaacatccttaactatgatgagcaaggaggcggggag
gaggaccaggatgcgtacgacataaaccagctgcgccacccagtggagccgagggccaca
agtcgctctttgggcaggccacccctgcgcagggatgcccccttcagctatgtgccacag
ccacatcgagtgcttcccaccagcccatctgacattgccaacttcatcagtgatggcttg
gaggctgcggacagcgaccccagcgtgcctccctacgacacagctctcatctatgactac
gagggagatggctctgtggcagggacgctgagctccattctgtccagcctgggagatgaa
gaccaggactatgactacctccgggactggggaccccgctttgctcggctggcggacatg
tatggacatcagtga

DBGET integrated database retrieval system