KEGG   Mus musculus (house mouse): 12561
Entry
12561             CDS       T01002                                 
Symbol
Cdh4, AW120700, R-CAD, R-Cadh, Rcad
Name
(RefSeq) cadherin 4
  KO
K06797  cadherin 4, type 1, R-cadherin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12561 (Cdh4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    12561 (Cdh4)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   12561 (Cdh4)
SSDB
Motif
Pfam: Cadherin Cadherin_pro CADH_Y-type_LIR Cadherin_3 He_PIG Stevor Cytomega_TRL10 RIFIN
Other DBs
NCBI-GeneID: 12561
NCBI-ProteinID: NP_033997
MGI: 99218
Ensembl: ENSMUSG00000000305
UniProt: P39038 Q80ZV4
LinkDB
Position
2:179084216..179541168
AA seq 913 aa
MTTGSVLPLLLLGLSGALRAHREDLTVREACKAGFSEEGYTALISPNVLEGEKLLKVEFS
SCVGTKGMQYETNSLDFKVGADGTVFATRELKIPSEQVAFTVTARERQSAEQWAAMVRLL
VAQTSSAHSEHKKGQTVALDPSQPPNDTLLPWPQHQSSGGLRRQKRDWVIPPINVPENSR
GPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFNIDSMSGRMYVTRPMDREERASY
HLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEFINQVYNGSVDEGSKPGTYVMTVTAND
ADDSTTANGMVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDREKVQQYTVIVQATD
MEGNLNYGLSNTATAIITVTDVNDNPPEFTTSTFAGEVPENRIETVVANLTVMDRDQPHS
PNWNAVYRIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPLASG
IQMSFQSTAGVTISVTDVNEAPYFPSNHKLIRLEEGVPAGTALTTFSAVDPDRFMQQAVR
YSKLSDPANWLHINTSNGQITTAAILDRESLYTKNNVYEATFLAADNGIPPASGTGTLQI
YLIDINDNAPQLLPKEAQICERPGLNAINITAADADMDPNIGPYVFELPFIPTTVRKNWT
ITRLNGDYAQLSLRILYLEAGVYDVPIIVTDSGNPPLSNTSVIKVKVCPCDENGDCTTVG
AVAAAGLGTGAIVAILICIVILLIMVLLFVVWMKRREKERHTKQLLIDPEDDVRDNILKY
DEEGGGEEDQDYDLSQLQQPEAMEHVLSKTPGVRRVDERPVGAEPQYPVRPVVPHPGDIG
DFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNDWGPRF
KKLADMYGGGEED
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgaccacaggctctgtgctgccgctgctgctgctcgggctctcgggcgcgctccgggcc
caccgtgaggatcttacagtcagagaggcctgtaaggctggcttctccgaagaaggctac
actgcgttgatctccccgaatgtcctggaaggagagaaactactcaaagtcgagttcagc
agctgcgtgggcaccaaaggtatgcagtatgagaccaacagcttggacttcaaagtcggg
gcggatgggacagtcttcgccactagggagttgaagatcccctcagagcaggtggccttt
accgtcactgcgcgggaacgccagagtgctgagcaatgggctgctatggtgcggctgctg
gtagcccagacatcgtcagcacactctgaacacaagaaagggcagacagtggccctagac
ccctctcagccgccaaatgacacactgctgccatggcctcaacatcagagctctggtggg
ctgaggagacagaagcgtgactgggtcatcccacccatcaacgttcccgagaactcccgt
ggacccttccctcagcagcttgtcaggatcaggtcggacaaagacaatgacatccccatc
cgctacagcatcacgggtgtgggcgccgaccagccccccatggaggtcttcaacatcgac
tctatgtctggccggatgtatgtcactcggcccatggaccgggaggaaagagcctcttac
catctccgagcccacgcggtggatatgaacggtaacaaggtggagaatcctattgacctg
tacatctacgtcattgacatgaacgacaaccgtcccgagttcatcaaccaggtctacaac
ggctctgtggatgagggctccaagccaggtacatatgtgatgaccgtcacagccaacgat
gcagatgatagcaccacagccaatggcatggtgaggtacagaattgtcacccagacaccc
cagagcccatcccagaatatgttcaccatcaacagtgaaacaggggacatcgtgaccgtg
gcagcaggcctggacagagagaaagtccagcagtacaccgtcatcgtccaggccactgac
atggaaggaaaccttaattatggtctctcgaacacagccactgccatcatcacggtgaca
gacgtaaatgacaaccctccggaattcaccacaagcacatttgcaggagaggttcctgag
aaccgtatagagacagtagtagccaacctcacggtgatggaccgagaccagccccactca
cccaactggaacgccgtctaccgaatcataagtggggacccctctgggcacttcagtgtc
cgcacagaccccgtgaccaatgagggcatggtcaccgtggtgaaggcagtggactatgag
ctgaaccgtgccttcatgctgaccgtaatggtgtccaaccaggcgcccctggccagtggg
atccagatgtccttccagtccacagcaggggtaaccatctctgtcaccgatgtcaacgag
gccccctacttcccctccaaccacaaactgatccgcctggaagagggtgtgcccgctggg
acagcactcaccactttttctgcagtggaccctgaccggttcatgcagcaagccgtgagg
tactccaaactgtctgatcccgccaactggctgcacatcaacacatccaatgggcagatc
accacagccgccattctggaccgagagtccctctacaccaagaacaatgtatatgaggcc
accttcctggctgctgacaatgggatccccccagccagtggcactgggaccctgcagatc
tacctcattgatatcaatgacaacgcaccacagctgctacccaaggaggcacagatctgc
gagaggcccggcctcaatgccatcaacatcactgcagccgacgccgatatggaccccaac
attggcccctatgtctttgagttgcccttcatccccactacagtgaggaagaattggacc
atcacccgcctaaatggtgactatgcccagctcagtctgagaatcctgtatctggaagca
ggggtgtatgacgtccccatcatcgtcacagactctggcaaccctcccttgtccaataca
tctgtcataaaggtcaaggtgtgcccatgtgatgagaacggcgactgtaccacggtcggc
gcagtggctgcagctggcctgggcacgggcgccatcgtggcgatcctcatctgcatcgtg
atcctgctaatcatggttctgctgttcgttgtgtggatgaagcggagagaaaaggagagg
cacacaaagcagctgctcatcgaccctgaggatgacgtgagggacaacatcctgaagtac
gatgaagagggcggtggcgaggaggaccaagactacgacctcagccagctgcaacagcca
gaagccatggagcatgtgctgagcaaaactcctggtgtgcggcgggtggatgaacggcca
gtaggtgctgaaccccagtacccagtcaggcctgtggtgccacacccaggagacattgga
gacttcattaatgagggactccgagctgctgacaatgaccccaccgcacccccctacgac
tccctgctagtcttcgactatgaaggcagcggttctactgcgggctctgtcagctcccta
aactcctccagctccggggatcaagattacgactacttaaatgactgggggccccggttc
aagaagctggcggacatgtatgggggtggcgaggaggactaa

DBGET integrated database retrieval system