Mus musculus (house mouse): 12740 Help Entry 12740             CDS       T01002                                  Symbol Cldn4, Cep-r, Cpetr, Cpetr1 Name (RefSeq) claudin 4   KO K06087   claudin Organism mmu  Mus musculus (house mouse) Pathway mmu03272   Virion - Hepatitis viruses mmu04382   Cornified envelope formation mmu04514   Cell adhesion molecule (CAM) interaction mmu04530   Tight junction mmu04670   Leukocyte transendothelial migration mmu05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     12740 (Cldn4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     12740 (Cldn4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     12740 (Cldn4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     12740 (Cldn4)   09158 Development and regeneration    04382 Cornified envelope formation     12740 (Cldn4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     12740 (Cldn4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mmu03037]     12740 (Cldn4)    04147 Exosome [BR:mmu04147]     12740 (Cldn4) Cilium and associated proteins [BR:mmu03037]  Other cilia and associated proteins   Stereociliary proteins    12740 (Cldn4) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    12740 (Cldn4)   Exosomal proteins of colorectal cancer cells    12740 (Cldn4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 L_HMGIC_fpl Motif Other DBs NCBI-GeneID:  12740 NCBI-ProteinID:  NP_034033 MGI:  1313314 Ensembl:  ENSMUSG00000047501 UniProt:  O35054 Q3UM35 LinkDB All DBs Position 5:complement(134973977..134975788) Genome browser AA seq 210 aa AA seqDB search MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMIT AGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGL LCCSCPPRSNDKPYSAKYSAARSVPASNYV NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggcgtctatgggactacaggtcctgggaatctccttggcagtcctgggctggctgggg atcatcctgagttgtgcgctccccatgtggcgggtgaccgccttcatcggcagcaacatc gtcacggcacagaccagctgggagggcctctggatgaactgcgtggtgcagagcacaggt cagatgcagtgcaagatgtacgactcgatgctcgccctgccgcaggacctgcaggccgcc cgagcccttatggtcatcagcatcatcgtgggtgctctggggatgcttctctcagtggta gggggcaagtgcaccaactgcatggaggacgagaccgtcaaggccaagatcatgatcacc gccggagccgtgttcatcgtggcaagcatgctgattatggtgcccgtgtcctggaccgct cacaacgtcatccgcgacttctacaaccctatggtggcttccgggcagaagagggaaatg ggggcctcgctttacgtcggctgggcggcctccgggctgctgctcctgggaggaggcctc ctctgctgcagttgcccacctcgtagcaacgacaagccctactcggccaagtactccgcc gcccgctctgtccccgccagcaactatgtgtaa

DBGET integrated database retrieval system