KEGG   Mus musculus (house mouse): 12753
Entry
12753             CDS       T01002                                 
Symbol
Clock, 5330400M04Rik, KAT13D
Name
(RefSeq) circadian locomotor output cycles kaput
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
mmu04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    12753 (Clock)
  09159 Environmental adaptation
   04710 Circadian rhythm
    12753 (Clock)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12753 (Clock)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12753 (Clock)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     12753 (Clock)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    12753 (Clock)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    12753 (Clock)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9 DUF6080
Other DBs
NCBI-GeneID: 12753
NCBI-ProteinID: NP_001276755
MGI: 99698
Ensembl: ENSMUSG00000029238
UniProt: O08785 Q8C9W6
Structure
LinkDB
Position
5:complement(76357715..76452675)
AA seq 855 aa
MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSF
SSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQV
VPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNT
MVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVM
VPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQ
QPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPR
HRTDSLTDPSKVQPQ
NT seq 2568 nt   +upstreamnt  +downstreamnt
atggtgtttaccgtaagctgtagtaaaatgagctcaattgttgacagagatgacagtagt
atttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatcagaaaagaaacgtagagatcagttcaatgtcctcattaaggagctggggtctatg
cttcctggtaacgcgagaaagatggacaagtctactgttctacagaagagcattgatttt
ttgcgcaaacataaagagaccactgcacagtcagatgctagtgagattcgacaggactgg
aaacccacattccttagtaatgaagagtttacacagttaatgttagaggctcttgatggt
ttttttttagcgatcatgacagatggaagtataatatatgtatctgagagtgtaacttcg
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagag
ggagaacattcagaggtttataagatactctctactcatctgctggaaagtgactcatta
acccctgagtacttaaaatcaaaaaatcagttagaattctgttgtcacatgcttcgagga
acaatagacccaaaggagccatccacctatgaatatgtgagatttataggaaattttaaa
tctttaaccagtgtatcaacttcaacacacaatggttttgaaggaactatacaacgcaca
cataggccttcttatgaagatagagtttgttttgtagctactgtcagattagctacacct
cagttcatcaaggaaatgtgtactgttgaagaaccaaatgaagagtttacatctagacac
agtttagaatggaagtttctatttttagatcacagggcaccaccaataataggctatttg
ccatttgaagtcttgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ctggcaaaatgtcacgagcacttaatgcaatatggaaaaggcaaatcgtgttactataga
ttcctgaccaaaggccagcagtggatatggcttcagactcattattatattacttaccat
cagtggaattcaaggccagagttcattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacggcgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtctgacaatcgtatcaacacagtgagtctcaaggaagca
ctggaaaggtttgatcacagcccaactccttctgcctcctctagaagctcacgaaagtca
tctcacaccgcagtctcagacccttcctccacaccgacaaagatccctactgatactagc
actcctcccagacagcatttgccagctcatgaaaagatgacacagcggaggtcgtccttc
agcagtcagtccataaactcccagtcagttggtccatcattaacacagccagcgatgtct
caagctgcaaatttaccaattccacaaggcatgtcacagtttcagttttcagctcagtta
ggagccatgcagcatctaaaagaccagctagagcagcggacacggatgatagaggcaaat
attcatcggcagcaagaagaactaaggaaaattcaagagcaacttcagatggtccatggt
caagggctacagatgtttttgcagcaatcaaaccctggattgaattttggttctgttcaa
ctttcctctggaaattctaatatccagcaactcacacctgtaaatatgcaaggccaggtt
gtccctgctaaccaggttcagagtggacatatcagcacaggccagcacatgatacagcaa
cagactttacaaagtacatcaactcagcagagtcaacagagtgtaatgagtggacacagt
cagcagacgtctcttccaagtcagacaccgagcactctcacagccccactgtacaatacg
atggtgatttcccagcctgcagctgggagcatggtccagattccatccagtatgccacag
aacagtacccagagtgctacagtcactacgttcactcaggacagacagataagattttct
caaggtcagcaacttgtgaccaaattagtgactgctcctgtagcttgtggggccgtcatg
gtaccaagtaccatgcttatgggtcaggtggtgactgcctatcctaccttcgccacacaa
cagcagcaggcacagacattatcggtaacacaacagcagcagcagcagcagcagcagcca
ccacagcaacagcaacaacaacagcagagttcccaggaacagcagcttccttcagttcag
cagccagctcaggcccagctgggccagccaccacagcagttcttacagacatctaggttg
ctccacgggaatccttcgacacagctcatcctctctgctgcctttccactacaacagagc
actttccctccttcgcaccaccagcaacaccagcctcagcagcaacagcagcttcctcgg
cacaggactgacagcctgactgacccttccaaggtccagccacagtag

KEGG   Mus musculus (house mouse): 18143
Entry
18143             CDS       T01002                                 
Symbol
Npas2, MOP4, bHLHe9
Name
(RefSeq) neuronal PAS domain protein 2
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    18143 (Npas2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18143 (Npas2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    18143 (Npas2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 18143
NCBI-ProteinID: NP_032745
MGI: 109232
Ensembl: ENSMUSG00000026077
UniProt: P97460 Q32ME6 G3X9B7
LinkDB
Position
1:39233013..39402321
AA seq 816 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFVIVVTTDGSIIYVSDSITPLLGHL
PADVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEFLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCHVPLGKDVCFIATVRLATPQFLKE
MCVADEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGASGLPSSPSPSASSRSSHKSSH
TAMSEPTSTPTKLMAENSTTALPRPATLPQELPVQGLSQAATMPTALHSSASCDLTKQLL
LQSLPQTGLQSPPAPVTQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCL
VQDSNVQMFLQQPAVSLSFSSTQRPAAQQQLQQRPAAPSQPQLVVNTPLQGQITSTQVTN
QHLLRESNVISAQGPKPMRSSQLLPASGRSLSSLPSQFSSTASVLPPGLSLTTIAPTPQD
DSQCQPSPDFGHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQVMFPSPD
SHPTNSSASTPVLLMGQAVLHPSFPASRPSPLQPAQAQQQPPPYLQAPTSLHSEQPDSLL
LSTFSQQPGTLGYAATQSTPPQPPRPSRRVSRLSES
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggacgaagatgagaaggatagagcaaagagagcctctcgaaataagtctgagaagaag
cgtcgggaccagttcaatgttctcatcaaagagctcagctccatgctccctggtaacact
cggaaaatggacaaaaccaccgtgctggagaaggtcatcggattcttgcagaaacacaat
gaagtctcagcacaaacagaaatctgtgacatccagcaggactggaagccatcattcctc
agtaacgaagaattcacccagctgatgttggaggcattagatggcttcgtcatcgtcgtg
acaacagacggcagcatcatctatgtgtccgacagtatcacacctctccttggacattta
ccggcggatgtcatggatcagaacttgttaaatttccttccagagcaagaacattccgaa
gtttataaaatcctttcttcccatatgcttgtgacggattccccctccccagaattccta
aaatctgacaacgatttagagttttattgccatcttctcagaggcagcttgaacccaaag
gaatttccaacttacgaatatataaaatttgtaggaaattttcgctcttacaacaatgtg
cctagcccctcctgtaatggctttgacaacaccctttcaagaccctgccatgtaccccta
ggaaaggacgtctgcttcatcgccaccgtgcgcctggcaaccccgcagttcttaaaggaa
atgtgtgtagctgacgaacctttagaggaattcacttcgaggcatagcttggaatggaaa
tttttatttctggatcacagagctcctccaatcataggatacctgccctttgaagtactt
ggcacctcaggctacgactactaccacattgatgacctggagctcctggccaggtgccac
cagcatctgatgcagtttggcaaagggaagtcgtgctgttaccggtttctaaccaaaggg
cagcagtggatttggttgcaaacccactactacatcacctaccaccaatggaactccaag
cctgagttcatcgtatgcacacactcagtggtcagttacgcagatgttcgagtggaaagg
agacaggagctggctctggaagacccacccacagaggccatgcacccctctgcagtgaag
gaaaaggactcaagcctagagcctccacagccctttaatgcacttgacatgggcgcctca
ggtcttcccagcagcccttctccatcagcctcctcaaggagttcccacaagtcctcacac
acagccatgtcagaacccacctccactccaaccaagctgatggctgagaacagcaccaca
gctttgccaagaccggccaccctaccccaggagttaccagtgcaggggctcagccaggca
gccacaatgccgactgctctgcattcctcagcctcctgcgacctcacaaagcaactcctg
ctgcagagcctgcctcagaccggcttgcagagtccacctgctccagtgacacagttttca
gcacaattcagcatgttccagaccattaaagaccaactggagcagaggacacggatcctg
caggccaacattcggtggcagcaggaagagcttcataagatccaggaacaactctgcctg
gtccaggactccaacgtccagatgtttctgcagcagccagctgtgtccctgagcttcagc
agtacgcagcgaccagcagctcagcagcagctgcagcaaaggcccgccgcaccgtctcag
ccccagcttgtggtcaacactccactgcaggggcagatcacatccacccaagtcacaaac
cagcacctgctccgagaatcgaatgtgatatccgcccagggtccaaagccaatgagaagt
tcccagctgctgcctgccagcggccgttcactgagcagcctgccatcccagtttagcagt
acagcttccgtgctcccgcctggcctgagcctcaccacgattgctcccacccctcaggat
gacagccagtgccagcccagccctgacttcggccatgatcggcagctcaggctgttgctg
agccagcccatccagcctatgatgcctgggtcctgcgatgccaggcagccctcagaagtc
agcagaactggacggcaagtcaagtatgcacagagccaagtgatgtttccaagtccagac
tcacaccctaccaacagcagcgcatccaccccggtcctgctcatggggcaggcagtactc
catcccagcttccctgcttcccggccatcgccactgcagccagcacaggcacagcagcag
ccaccaccctatttgcaggcaccaacatctctgcacagtgagcagccggactcgctcctt
ctctccaccttctcccagcagccgggaaccctgggctatgcagccacacagtctacacct
ccgcaacccccacgcccctcccgcagggtcagccggctgtcagagtcctaa

DBGET integrated database retrieval system