KEGG   Mus musculus (house mouse): 12805
Entry
12805             CDS       T01002                                 
Symbol
Cntn1, AW495098, CNTN, F3cam, usl
Name
(RefSeq) contactin 1
  KO
K06759  contactin 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12805 (Cntn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    12805 (Cntn1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    12805 (Cntn1)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Contactins
   12805 (Cntn1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  12805 (Cntn1)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_5 Ig_4 Pur_ac_phosph_N C2-set_2 Big_3_4 ChitinaseA_N
Other DBs
NCBI-GeneID: 12805
NCBI-ProteinID: NP_001153119
MGI: 105980
Ensembl: ENSMUSG00000055022
UniProt: P12960
LinkDB
Position
15:91949034..92239848
AA seq 1020 aa
MKMPLLVSHLLLISLTSCLGDFTWHRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTNDRYSMVGGNLVINNPDKQKDAGVYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVESSDRGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDIYTMMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGLYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIP
TIRWLKNGYSYHKGELRLYDVTFENAGMYQCIAENAYGSIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITNPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKEITHIHYQRNFMLDANGELLIRNAQLKHAGRYTCTAQTIVDNSSASADL
VVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPI
IEGNMESAKAVDLIPWMEYEFRVVATNTLGTGEPSIPSNRIKTDGAAPNVAPSDVGGGGG
TNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMTPST
AFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWKHVLEKIVE
SYQIRYWAGHDKEAAAHRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPSSDVIET
FTRKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKILYRPDGQHDGKLFSTH
KHSIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGVSTLSSSLLSLLLPSLGFLVYSEF
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgaaaatgccattgctggtcagccatctcctgctaatctccttaacatcttgtctagga
gactttacctggcacagaagatatggtcatggagtgtctgaggaggacaaaggatttggg
cccatttttgaagagcagccaatcaataccatttacccagaagagtcactggaaggaaaa
gtgtcactcaactgccgggcacgcgccagcccatttccagtttacaaatggagaatgaat
aacggggacgtggacctgacaaacgatcggtacagtatggtcggaggaaaccttgttatc
aacaacccggacaaacagaaagacgctggggtgtactactgcctggcatccaacaactac
ggaatggtcaggagcacggaggcaactctgagcttcgggtatctcgacccctttcctccc
gaggagcgtccggaagtgaaggtgaaggaagggaagggcatggtgcttctctgtgatcct
ccctaccacttcccagatgatcttagctaccgctggcttctgaatgaatttcctgtattt
atcaccatggataagcgaagatttgtgtctcagaccaacggcaatctctacatcgcaaat
gtcgagtcttctgacagaggcaactactcctgctttgtgtccagtccttctattacaaag
agtgtgttcagcaagtttattcccctcattccgattcctgaacgaacaacaaagccatat
cctgctgatattgtggtgcagttcaaggacatatacaccatgatgggccaaaatgtgact
ttagagtgtttcgctctagggaaccctgttcctgatatccggtggcggaaggtgctagaa
ccaatgcccagcactgctgagataagcacgtcaggggctgtcctcaagatcttcaacatc
cagctagaagatgaaggcctctacgagtgtgaggctgagaacatccggggaaaggacaag
caccaggcaagaatctatgttcaagcgtttcctgagtgggtagagcatatcaatgacact
gaggtggacataggcagtgacctctactggccttgcatagccacagggaagcccattcct
accatcaggtggctgaaaaatggatactcgtatcacaaaggggaactgagactgtatgat
gtgacttttgaaaatgccgggatgtaccagtgcatagcagaaaacgcgtatgggtccatt
tatgccaacgctgagctcaagatcctggctttagctccaacttttgaaatgaatcctatg
aagaaaaagatcttggctgcgaaaggtggaagggttatcattgaatgtaaacccaaggcc
gcaccaaaacccaagttttcatggagcaaagggacggagtggctcgttaacagcagcaga
atactcatatgggaagatggtagcttggaaatcaataatattacaagaaatgatggtgga
atctatacatgctttgcagaaaataacagaggaaaagctaatagcactgggactctggtg
atcacaaatcccacacgaattattttggccccaatcaatgctgacatcactgttggggaa
aatgccaccatgcagtgtgctgcgtctttcgatcctgccttggacctcacgtttgtgtgg
tccttcaatggctacgtgattgactttaacaaggaaattacgcatatccattaccagagg
aattttatgctcgacgccaatggggaactgctcatccgaaatgcgcagctgaaacacgca
ggccggtacacgtgcacggcgcagacaatcgtggacaattcctcggcttccgctgacctt
gtcgttcgaggccccccaggtcccccaggaggcctgagaatagaagacatcagagctacc
tctgtggcactgacttggagccgtggttccgacaatcacagccctatctctaaatacacg
atccagaccaagacgattctctcagatgactggaaagatgcgaagacagatcccccaatc
attgaaggaaacatggagtcagcaaaagcagtggatttgatcccttggatggagtatgaa
tttcgagtggtggcgaccaatactttagggacaggagagcccagcataccctcaaacagg
atcaaaacagacggtgctgcaccaaatgtggctccctcagatgtaggcggtgggggcgga
accaacagagagctgacaataacgtgggcgcctttgtcgagagagtaccattacggtaac
aattttggttacatagtggcgtttaagccatttgatggagaagagtggaagaaagtgact
gtgactaacccagacactggccgctacgtccacaaagatgagaccatgaccccctccacc
gcgtttcaagtcaaagtgaaagccttcaacaataaaggagatgggccctacagcctcgta
gctgtcatcaactctgcacaagatgctcccagtgaagcccccacagaggtaggggtcaaa
gtgttatcatcctctgagatatctgtccattggaagcatgtgttagagaaaattgtggaa
agctatcagattcggtactgggctgggcatgacaaagaagcagccgcacacagagttcag
gtcaccagccaggagtactcagccagactggagaaccttcttcccgacacccagtacttc
attgaagtgggagcctgcaacagtgccggatgcggaccttccagtgatgtgatcgagacc
ttcaccagaaaagcccctcctagccaaccaccaaggatcatcagttcggtgagatctggc
tcacgatatataatcacatgggatcacgttgtggcactatccaatgaatctactgtgaca
ggctacaagatactctatagaccggatggccaacatgacggcaagctgttctcaacccat
aaacactccatagaagtccccatccccagagacggagagtatgttgtcgaggttcgagca
cacagcgacgggggagacggagtcgtgtctcaagtcaaaatttcaggcgtgtccacgctg
tcttcgagtctcctcagcttgctcctgccctcccttggctttcttgtctactcggaattc
tga

DBGET integrated database retrieval system