KEGG   Mus musculus (house mouse): 13006
Entry
13006             CDS       T01002                                 
Symbol
Smc3, Bamacan, Cspg6, HCAP, Mmip1, SMC-3, SmcD
Name
(RefSeq) structural maintenance of chromosomes 3
  KO
K06669  structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6)
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    13006 (Smc3)
   04114 Oocyte meiosis
    13006 (Smc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    13006 (Smc3)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    13006 (Smc3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    13006 (Smc3)
  Meiosis-specific sister chromatid cohesion proteins
   Cohesin complex and associated proteins
    13006 (Smc3)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   13006 (Smc3)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_15 AAA_21 AAA_23 AAA_29 Muted
Other DBs
NCBI-GeneID: 13006
NCBI-ProteinID: NP_031816
MGI: 1339795
Ensembl: ENSMUSG00000024974
UniProt: Q9CW03 Q1HL32 Q3TMK9
Structure
LinkDB
Position
19:53588827..53634262
AA seq 1217 aa
MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQ
RLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKND
VMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMK
ETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLD
ELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIK
QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEER
GIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDL
EDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQ
QALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRKGINQHVQNGYHGIVMNNF
ECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAY
PETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSH
RGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINNEIDQLMNQMQQ
IETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAE
LGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRL
DQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKS
MERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTL
SLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNV
LELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERG
SGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFY
LFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDV
ITAEMAKDFVEDDTTHG
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgtacatcaagcaggtgatcatccagggcttccgaagttaccgagaccaaacaattgta
gatcccttcagctccaaacataatgtcatcgtgggcagaaatggctctggaaaaagcaac
ttcttttatgcaatccagtttgttctcagtgatgaattcagccatcttcgtccagagcag
cgattggctttgttgcatgagggtacaggtcctcgtgttatttctgcttttgtggaaatc
atttttgacaattcggacaaccggttaccaattgataaagaggaagtttcacttcgaaga
gttattggtgccaaaaaggatcagtatttcctagataagaagatggtcacgaaaaatgat
gtgatgaatctccttgaaagtgctgggttttccagaagtaatccttattacattgttaaa
caaggaaagatcaaccaaatggcaacggcaccagattctcagagattaaagctgttgaga
gaagtagctggtactagagtgtatgatgaacggaaagaagaaagcatctccctgatgaaa
gaaacagagggcaaacgggaaaagatcaatgagttgttgaagtacattgaagagcgcctg
cacactctagaggaggagaaggaggagctggcccagtatcagaagtgggataagatgagg
cgcgccctggagtacaccatctacaaccaggagctcaacgagacgcgcgctaagctcgac
gagctttctgctaagcgagaaacgagtggagagaaatccagacaactaagggatgcccag
caggatgcaagagacaaaatggaggatattgagcgccaggttagagaactgaaaacaaaa
atttcagccatgaaagaagaaaaagaacagcttagtgctgaaagacaagagcagattaag
caaaggaccaagttggagcttaaagccaaggatttacaagatgagctggcgggcaacagt
gaacagcggaaacgtttattaaaagagaggcagaagctgcttgaaaaaatagaagaaaag
cagaaagaactggcagaaacagaacctaaattcaacagcgtaaaagaaaaagaagagcga
ggaattgcgaggttggctcaagctacacaggaaagaactgatctttatgcaaagcagggt
cgaggaagccagtttacgtcaaaagaagaaagggataaatggattaaaaaggaactgaag
tctttagatcaggcaattaatgataagaaaagacagattgctgctattcacaaggatttg
gaggataccgaggcaaataaagagaaaaatctggagcaatataataaattggatcaggat
ctcaatgaagtcaaagctcgagttgaagaactggacagaaaatattatgaagtaaaaaat
aagaaagatgaactacaaagtgaaagaaattacttgtggagagaggagaatgcagaacaa
caagcacttgctgctaaaagagaagaccttgagaagaagcagcaacttcttagagcggca
acaggaaaggccattttaaatggaatagatagcattaacaaagtgctagaacattttcgg
cgaaaaggtataaaccagcatgttcaaaatggctaccatggcatcgtaatgaataacttt
gagtgtgaaccagctttctatacttgtgtggaagtcactgctggtaacaggttattttat
cacattgttgattcagatgaagtcagcacgaaaattttaatggagttcaataaaatgaat
cttcctggagaggtgactttcctgcctcttaacaagttagatgtgagagatactgcctat
cctgaaactaacgatgctattcctatgatcagtaagctgaggtacaatcccagatttgac
aaagctttcaaacatgtatttggaaagacactcatctgtcggagcatggaagtttcaact
cagctggcccgggccttcactatggactgtattactttggaaggtgatcaagtcagccat
cgaggtgctctgactggaggttattacgacacaagaaagtctcgacttgagttacagaaa
gacgttaggaaggcagaggaggagctgggtgagctggaggctaagctcaatgaaaaccta
cgcaggaacattgaaaggattaataatgaaattgaccagttgatgaaccaaatgcagcag
atagagacccaacaaagaaaatttaaagcatccagagatagcatattatcagagatgaag
atgctaaaagagaagagacagcaatcagaaaagaccttcatgccaaagcaacgtagctta
caaagcttggaggcaagtctgcatgctatggagtccaccagagagtcactgaaagcggag
ctaggaacggatttgctttctcaactcagtctggaagatcagaaaagagtcgacgctctg
aatgatgaaatccgtcagctgcagcaggaaaacagacagctgctaaatgaaagaattaaa
ctagaaggcattattactcgagtagagacttacctgaatgagaatctgaggaaacgcttg
gaccaagtagaacaggaacttaatgaactgagagagacagaaggtggtactgttcttact
gccacaacatcagaacttgaagctattaataaaagagtaaaagatactatggcaagatca
gaagatttggacaattccattgacaaaacagaagctggaattaaagagctccagaaaagt
atggagcgctggaaaaatatggagaaagaacacatggatgccataaatcatgatactaaa
gagctggagaagatgaccaaccggcaaggcatgctgttgaagaagaaggaggagtgtatg
aagaagatccgggagctggggtccctcccccaggaagcgtttgagaagtaccagacactg
agcctgaagcagttgtttcgaaaactggagcaatgcaacacagagttaaagaagtacagc
cacgtgaacaaaaaggctctagatcagtttgtgaatttctctgagcagaaggaaaagctg
ataaagcggcaagaggaattggatagaggctacaaatcaatcatggaattgatgaatgta
cttgaacttagaaaatatgaagctattcagttaactttcaaacaggtatctaagaacttc
agtgaagttttccagaagttggtacctggtggcaaagcgactttggtgatgaagaaagga
gatgtggagggcagccagtctcaggacgaaggagaagggagtggcgagagtgagcggggc
tctgggtcacagagcagtgttccatcagttgaccagttcacaggagttgggatcagggtg
tcatttacagggaagcaaggggagatgagagaaatgcagcagctctcaggaggacagaaa
tctctggtagcccttgctctcatctttgccattcagaaatgcgaccctgctcctttttac
ctgtttgatgagatcgaccaagctttggatgctcagcacagaaaagccgtgtcagatatg
attatggagctagccgtgcatgcccagtttattaccactactttcaggcctgaactgctt
gagtcagctgacaaattctatggtgtaaagttcagaaataaggttagtcacattgatgtg
atcacagcagagatggccaaagattttgtagaagacgataccacgcatggttaa

DBGET integrated database retrieval system