Mus musculus (house mouse): 13135 Help Entry 13135             CDS       T01002                                  Symbol Dad1 Name (RefSeq) defender against cell death 1   KO K12668   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit DAD1/OST2 Organism mmu  Mus musculus (house mouse) Pathway mmu00510   N-Glycan biosynthesis mmu00513   Various types of N-glycan biosynthesis mmu01100   Metabolic pathways mmu04141   Protein processing in endoplasmic reticulum Module mmu_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mmu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     13135 (Dad1)    00513 Various types of N-glycan biosynthesis     13135 (Dad1)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     13135 (Dad1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DAD Motif Other DBs NCBI-GeneID:  13135 NCBI-ProteinID:  NP_001106829 MGI:  101912 Ensembl:  ENSMUSG00000022174 UniProt:  P61804 LinkDB All DBs Position 14:complement(54472942..54491386) Genome browser AA seq 113 aa AA seqDB search MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgtcggcgtctgtggtgtccgtcatctcccggttcctggaggagtacttgagctccact ccgcagcggctgaagttgctggacgcctatctcctttatatactgctgaccggggcgctg cagttcggctactgtctcctcgtgggcaccttccccttcaactctttcctctctggcttc atctcttgtgtgggcagcttcatcctagcggtttgcctgagaatacagatcaacccccag aacaaggcggacttccaaggcatctctccggagcgagcctttgctgacttcctctttgcc agcacgatcctgcaccttgtcgtcatgaacttcgttggctga

DBGET integrated database retrieval system