KEGG   Mus musculus (house mouse): 13170
Entry
13170             CDS       T01002                                 
Symbol
Dbp
Name
(RefSeq) D site albumin promoter binding protein
  KO
K09056  albumin D box-binding protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    13170 (Dbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13170 (Dbp)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   bZIP/PAR
    13170 (Dbp)
SSDB
Motif
Pfam: bZIP_2 bZIP_1
Other DBs
NCBI-GeneID: 13170
NCBI-ProteinID: NP_058670
MGI: 94866
Ensembl: ENSMUSG00000059824
UniProt: Q60925 Q3USN7
LinkDB
Position
7:45354518..45359627
AA seq 325 aa
MARPLSDRTPGPLLLGGPAGAPPGGGALLGLRSLLQGNSKPKEPASCLLKEKERKATLPS
APVPGPGLETAGPADAPSGAVSGGGSPRGRSGPVAGPSLFAPLLWERTLPFGDVEYVDLD
AFLLEHGLPPSPPPPGGLSPAPSPARTPAPSPGPGSCSSSSPRSSPGHAPARATLGAAGG
HRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPI
MKKARKVQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQE
VVAVRQELSHYRAVLSRYQAQHGTL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgcggcctctgagcgacaggaccccgggccccctgctgctgggtggcccggctggg
gccccccctggcgggggagcgctgcttgggctgaggagccttctgcagggaaacagcaag
cccaaagaaccggccagctgtctcctgaaggaaaaggagcgcaaggcaactctgccctca
gcccccgtcccgggacccggcctggaaacggcgggcccagccgatgccccgagtggggcc
gttagtggcggtgggtcccctcgggggcgctcagggcctgtggctggcccgagtcttttt
gcgccgctgctgtgggaacgcactttgcctttcggggacgtggaatacgtggacctggac
gccttcttgctggagcacgggctaccgccgagcccgccgccccccgggggcctgtcgccg
gcaccctctccagcgcgcactcccgcgccctcccccgggcccggctcttgcagctcctct
tccccccgctcctcgcccgggcacgcccccgcgcgggccactctgggagccgccggcggc
caccgcgcaggcttgacatctagggacacacccagtcctgtggacccagacaccgtggag
gtgctaatgacctttgaacctgatcccgctgatctcgccctgtcaagcattccaggccat
gagacttttgaccctcggagacaccgcttctcagaggaggaactgaagcctcaaccaatc
atgaagaaggcaaggaaagtccaggtgcctgaggaacagaaggatgagaagtactggagc
cggaggtacaagaacaatgaagcagccaagaggtcgagagatgcaagaagactcaaggag
aaccagatatctgtgcgggctgccttcctggagaaggaaaacgccctgttgcggcaggag
gtggtggctgtgcggcaggagctgtcccactaccgtgctgtgctttcacgctaccaggcc
cagcatgggacactgtga

DBGET integrated database retrieval system