KEGG   Mus musculus (mouse): 13405Help
Entry
13405             CDS       T01002                                 

Gene name
Dmd, DXSmh7, DXSmh9, Dp427, Dp71, dys, mdx, pke
Definition
(RefSeq) dystrophin, muscular dystrophy
  KO
K10366  dystrophin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    13405 (Dmd)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    13405 (Dmd)
   05414 Dilated cardiomyopathy (DCM)
    13405 (Dmd)
   05416 Viral myocarditis
    13405 (Dmd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    13405 (Dmd)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     13405 (Dmd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH EF-hand_2 EF-hand_3 ZZ WW CAMSAP_CH DUF3926
Motif
Other DBs
NCBI-GeneID: 13405
NCBI-ProteinID: NP_031894
MGI: 94909
Ensembl: ENSMUSG00000045103
Vega: OTTMUSG00000017938
UniProt: P11531
LinkDB All DBs
Position
X C1; X 38.38 cM
AA seq 3678 aa AA seqDB search
MLWWEEVEDCYEREDVQKKTFTKWINAQFSKFGKQHIDNLFSDLQDGKRLLDLLEGLTGQ
KLPKEKGSTRVHALNNVNKALRVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMKTIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTSSWSDGLALNALIHSHRPDL
FDWNSVVSQHSATQRLEHAFNIAKCQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLP
QQVSIEAIQEVEMLPRTSSKVTREEHFQLHHQMHYSQQITVSLAQGYEQTSSSPKPRFKS
YAFTQAAYVATSDSTQSPYPSQHLEAPRDKSLDSSLMETEVNLDSYQTALEEVLSWLLSA
EDTLRAQGEISNDVEEVKEQFHAHEGFMMDLTSHQGLVGNVLQLGSQLVGKGKLSEDEEA
EVQEQMNLLNSRWECLRVASMEKQSKLHKVLMDLQNQKLKELDDWLTKTEERTKKMEEEP
FGPDLEDLKCQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGD
RWANICRWTEDRWIVLQDILLKWQHFTEEQCLFSTWLSEKEDAMKNIQTSGFKDQNEMMS
SLHKISTLKIDLEKKKPTMEKLSSLNQDLLSALKNKSVTQKMEIWMENFAQRWDNLTQKL
EKSSAQISQAVTTTQPSLTQTTVMETVTMVTTREQIMVKHAQEELPPPPPQKKRQITVDS
ELRKRLDVDITELHSWITRSEAVLQSSEFAVYRKEGNISDLQEKVNAIAREKAEKFRKLQ
DASRSAQALVEQMANEGVNAESIRQASEQLNSRWTEFCQLLSERVNWLEYQTNIITFYNQ
LQQLEQMTTTAENLLKTQSTTLSEPTAIKSQLKICKDEVNRLSALQPQIEQLKIQSLQLK
EKGQGPMFLDADFVAFTNHFNHIFDGVRAKEKELQTIFDTLPPMRYQETMSSIRTWIQQS
ESKLSVPYLSVTEYEIMEERLGKLQALQSSLKEQQNGFNYLSDTVKEMAKKAPSEICQKY
LSEFEEIEGHWKKLSSQLVESCQKLEEHMNKLRKFQNHIKTLQKWMAEVDVFLKEEWPAL
GDAEILKKQLKQCRLLVGDIQTIQPSLNSVNEGGQKIKSEAELEFASRLETELRELNTQW
DHICRQVYTRKEALKAGLDKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQTAVE
EMKRAKEEALQKETKVKLLTETVNSVIAHAPPSAQEALKKELETLTTNYQWLCTRLNGKC
KTLEEVWACWHELLSYLEKANKWLNEVELKLKTMENVPAGPEEITEVLESLENLMHHSEE
NPNQIRLLAQTLTDGGVMDELINEELETFNSRWRELHEEAVRKQKLLEQSIQSAQEIEKS
LHLIQESLEFIDKQLAAYITDKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKDANQ
RVLSQIDVAQKKLQDVSMKFRLFQKPANFEQRLEESKMILDEVKMHLPALETKSVEQEVI
QSQLSHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAK
VTERKQQLEKCLKLSRKMRKEMNVLTEWLAATDTELTKRSAVEGMPSNLDSEVAWGKATQ
KEIEKQKAHLKSVTELGESLKMVLGKKETLVEDKLSLLNSNWIAVTSRVEEWLNLLLEYQ
KHMETFDQNIEQITKWIIHADELLDESEKKKPQQKEDILKRLKAEMNDMRPKVDSTRDQA
AKLMANRGDHCRKVVEPQISELNRRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLE
AEIQQGVNLKEEDFNKDMSEDNEGTVNELLQRGDNLQQRITDERKREEIKIKQQLLQTKH
NALKDLRSQRRKKALEISHQWYQYKRQADDLLKCLDEIEKKLASLPEPRDERKLKEIDRE
LQKKKEELNAVRRQAEGLSENGAAMAVEPTQIQLSKRWRQIESNFAQFRRLNFAQIHTLH
EETMVVTTEDMPLDVSYVPSTYLTEISHILQALSEVDHLLNTPELCAKDFEDLFKQEESL
KNIKDNLQQISGRIDIIHKKKTAALQSATSMEKVKVQEAVAQMDFQGEKLHRMYKERQGR
FDRSVEKWRHFHYDMKVFNQWLNEVEQFFKKTQNPENWEHAKYKWYLKELQDGIGQRQAV
VRTLNATGEEIIQQSSKTDVNILQEKLGSLSLRWHDICKELAERRKRIEEQKNVLSEFQR
DLNEFVLWLEEADNIAITPLGDEQQLKEQLEQVKLLAEELPLRQGILKQLNETGGAVLVS
APIRPEEQDKLEKKLKQTNLQWIKVSRALPEKQGELEVHLKDFRQLEEQLDHLLLWLSPI
RNQLEIYNQPSQAGPFDIKEIEVTVHGKQADVERLLSKGQHLYKEKPSTQPVKRKLEDLR
SEWEAVNHLLRELRTKQPDRAPGLSTTGASASQTVTLVTQSVVTKETVISKLEMPSSLLL
EVPALADFNRAWTELTDWLSLLDRVIKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQL
EELITAAQNLKNKTSNQEARTIITDRIERIQIQWDEVQEQLQNRRQQLNEMLKDSTQWLE
AKEEAEQVIGQVRGKLDSWKEGPHTVDAIQKKITETKQLAKDLRQRQISVDVANDLALKL
LRDYSADDTRKVHMITENINTSWGNIHKRVSEQEAALEETHRLLQQFPLDLEKFLSWITE
AETTANVLQDASRKEKLLEDSRGVRELMKPWQDLQGEIETHTDIYHNLDENGQKILRSLE
GSDEAPLLQRRLDNMNFKWSELQKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDE
LSRQAPIGGDFPAVQKQNDIHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQE
PRELPPEERAQNVTRLLRKQAEEVNAEWDKLNLRSADWQRKIDEALERLQELQEAADELD
LKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVNRVNDLAHQLTTLGI
QLSPYNLSTLEDLNTRWRLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISP
NKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLS
AACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYD
TGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQ
LGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETA
KHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGE
DVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQ
LSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQ
PRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMP
TSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVN
GTTVSSPSTSLQRSDSSQPMLLRVVGSQTSESMGEEDLLSPPQDTSTGLEEVMEQLNNSF
PSSRGRNAPGKPMREDTM
NT seq 11037 nt NT seq  +upstreamnt  +downstreamnt
atgctttggtgggaagaagtagaggactgttatgaaagagaagatgttcaaaagaaaaca
ttcacaaaatggataaatgcacaattttctaagtttggaaagcaacacatagacaacctc
ttcagtgacctgcaggatggaaaacgcctcctagacctcttggaaggccttacagggcaa
aaactgccaaaagaaaagggatctacaagagttcatgccctgaacaatgtcaacaaggca
ctgcgggtcttacagaaaaataatgttgatttagtgaatataggaagcactgacatagtg
gatggaaatcataaactcactcttggtttgatttggaatataatcctccactggcaggtc
aaaaatgtgatgaaaactatcatggctggattgcagcaaaccaacagtgaaaagattctt
ctgagctgggttcgacagtcaacacgtaattatccacaggttaacgtcatcaacttcacc
tctagctggtccgacgggttggctttgaatgctcttatccatagtcacaggcccgacctg
tttgattggaatagtgtggtttcacagcactcagccacccaaagactggaacatgccttc
aacattgcaaaatgccagttaggcatagaaaaacttcttgatcctgaagatgttgctacc
acttatccagacaagaagtccatcttaatgtacatcacatcactctttcaagttttgcca
caacaagtgagcattgaagccattcaagaagtggaaatgttgcccaggacatcttcaaaa
gtaactagagaagaacattttcaattacatcaccagatgcattactctcaacagatcaca
gtcagtctagcacagggctatgaacaaacttcttcatctcctaagcctcgattcaagagt
tatgccttcacacaggctgcttatgttgccacctctgattccacacagagcccctatcct
tcacagcatttggaagctcccagagacaagtcacttgacagttcattgatggagacggaa
gtaaatctggatagttaccaaactgctttagaagaagtactttcatggcttctttctgcc
gaggatacattgcgagcacaaggagagatttcaaatgatgttgaagaagtgaaagaacag
tttcatgctcatgagggattcatgatggatctgacatctcatcaaggacttgttggtaat
gttctacagttaggaagtcaactagttggaaaagggaaattatcagaagatgaagaagct
gaagtgcaagaacaaatgaatctcctaaattcaagatgggaatgtctcagggtagctagc
atggaaaaacaaagcaaattacacaaagttctaatggatctccagaatcagaaattaaaa
gaactagatgactggttaacaaaaactgaagagagaactaagaaaatggaggaagagccc
tttggacctgatcttgaagatctaaaatgccaagtacaacaacataaggtgcttcaagaa
gatctagaacaggagcaggtcagggtcaactcgctcactcacatggtagtagtggttgat
gaatccagcggtgatcatgcaacagctgctttggaagaacaacttaaggtactgggagat
cgatgggcaaatatctgcagatggactgaagaccgctggattgttttacaagatattctt
ctaaaatggcagcattttactgaagaacagtgcctttttagtacatggctttcagaaaaa
gaagatgcaatgaagaacattcagacaagtggctttaaagatcaaaatgaaatgatgtca
agtcttcacaaaatatctactttaaaaatagatctagaaaagaaaaagccaaccatggaa
aaactaagttcactcaatcaagatctactttcggcactgaaaaataagtcagtgactcaa
aagatggaaatctggatggaaaactttgcacaacgttgggacaatttaacccaaaaactt
gaaaagagttcagcacaaatttcacaggctgtcaccaccactcaaccatccctaacacag
acaactgtaatggaaacggtaactatggtgaccacaagggaacaaatcatggtaaaacat
gcccaagaggaacttccaccaccacctcctcaaaagaagaggcagataactgtggattct
gaactcaggaaaaggttggatgtcgatataactgaacttcacagttggattactcgttca
gaagctgtattacagagttctgaatttgcagtctatcgaaaagaaggcaacatctcagac
ttgcaagaaaaagtcaatgccatagcacgagaaaaagcagagaagttcagaaaactgcaa
gatgccagcagatcagctcaggccctggtggaacagatggcaaatgagggtgttaatgct
gaaagtatcagacaagcttcagaacaactgaacagccggtggacagaattctgccaattg
ctgagtgagagagttaactggctagagtatcaaaccaacatcattaccttttataatcag
ctacaacaattggaacagatgacaactactgccgaaaacttgttgaaaacccagtctacc
accctatcagagccaacagcaattaaaagccagttaaaaatttgtaaggatgaagtcaac
agattgtcagctcttcagcctcaaattgagcaattaaaaattcagagtctacaactgaaa
gaaaagggacaggggccaatgtttctggatgcagactttgtggcctttactaatcatttt
aaccacatctttgatggtgtgagggccaaagagaaagagctacagacaatttttgacact
ttaccaccaatgcgctatcaggagacaatgagtagcatcaggacgtggatccagcagtca
gaaagcaaactctctgtaccttatcttagtgttactgaatatgaaataatggaggagaga
ctcgggaaattacaggctctgcaaagttctttgaaagagcaacaaaatggcttcaactat
ctgagtgacactgtgaaggagatggccaagaaagcaccttcagaaatatgccagaaatat
ctgtcagaatttgaagagattgaggggcactggaagaaactttcctcccagttggtggaa
agctgccaaaagctagaagaacatatgaataaacttcgaaaatttcagaatcacataaaa
accttacagaaatggatggctgaagttgatgttttcctgaaagaggaatggcctgccctg
ggggatgctgaaatcctgaaaaaacagctcaaacaatgcagacttttagttggtgatatt
caaacaattcagcccagtttaaatagtgttaatgaaggtgggcagaagataaagagtgaa
gctgaacttgagtttgcatccagactggagacagaacttagagagcttaacactcagtgg
gatcacatatgccgccaggtctacaccagaaaggaagccttaaaggcaggtttggataaa
accgtaagcctccaaaaagatctatcagagatgcatgagtggatgacacaagctgaagaa
gaatatctagagagagattttgaatataaaactccagatgaattacagactgctgttgaa
gaaatgaagagagctaaagaagaggcactacaaaaagaaactaaagtgaaactccttact
gagactgtaaatagtgtaatagctcacgctccaccctcagcacaagaggccttaaaaaag
gaacttgaaactctgaccaccaactaccaatggctgtgcaccaggctgaatggaaaatgc
aaaactttggaagaagtttgggcatgttggcatgagttattgtcatatttagagaaagca
aacaagtggctcaatgaagtagaattgaaacttaaaaccatggaaaatgttcctgcagga
cctgaggaaatcactgaagtgctagaatctcttgaaaatctgatgcatcattcagaggag
aacccaaatcagattcgtctattggcacagactcttacagatggaggagtcatggatgaa
ctgatcaatgaggagcttgagacgtttaattctcgttggagggaactacatgaagaggct
gtgaggaaacaaaagttgcttgaacagagtatccagtctgcccaggaaattgaaaagtcc
ttgcacttaattcaggagtcgcttgaattcattgacaagcagttggcagcttatatcact
gacaaggtggatgcagctcaaatgcctcaggaagcccagaaaatccaatcagatttgaca
agtcatgagataagtttagaagaaatgaagaaacataaccaggggaaggatgccaaccaa
agggttctttcacaaattgatgttgcacagaaaaaattacaagatgtctccatgaaattt
cgattattccaaaaaccagccaattttgaacaacgtctagaggaaagtaagatgatttta
gatgaagtcaagatgcatttgcctgcattggaaaccaagagtgttgaacaggaagtaatt
cagtcacaactaagtcattgtgtgaacttgtataaaagcctgagtgaagtcaagtctgaa
gtggaaatggtgattaaaaccggacgtcaaattgtacagaaaaagcagacagaaaatccc
aaagagcttgatgaacgagtaacagctttgaaattgcattacaatgagttgggtgcgaag
gtaacagagagaaagcaacagttggagaaatgcttgaagttgtcccgtaagatgagaaag
gaaatgaatgtcttaacagaatggctggcagcaacagatacagaattgacgaagagatca
gcagttgaaggaatgccaagtaatttggattctgaagttgcctggggaaaggctactcaa
aaagagattgagaaacagaaggctcacttgaagagtgttacagaattaggagagtctttg
aaaatggtgttgggcaagaaagaaaccttggtagaagataaactgagtcttctgaacagt
aactggatagctgtcacctccagagtagaagaatggctaaatcttttgttggaataccag
aaacacatggaaacctttgatcagaacatagaacaaatcacaaagtggatcattcatgca
gatgaacttttagatgagtctgaaaagaagaaaccacaacaaaaggaagacattcttaag
cgtttaaaggctgaaatgaatgacatgcgcccaaaggtggactccacacgtgaccaagca
gcaaaattgatggcaaaccgcggtgaccactgcaggaaagtagtagagccccaaatctct
gagctcaaccgtcgatttgcagctatttctcacagaattaagactggaaaggcctccatt
cctttgaaggaattggagcagtttaactcagatatacaaaaattgcttgaaccactggag
gctgaaattcagcagggggtgaatctgaaagaggaagacttcaataaagatatgagtgaa
gacaatgagggtactgtaaatgaattgttgcaaagaggagacaacttacaacaaagaatc
acagatgagagaaagcgagaggaaataaagataaaacagcagctgttacagacaaaacat
aatgctctcaaggatttgaggtctcaaagaagaaaaaaggccctagaaatttctcaccag
tggtatcagtacaagaggcaggctgatgatctcctgaaatgcttggatgaaattgaaaaa
aaattagccagcctacctgaacccagagatgaaagaaaattaaaggaaattgatcgtgaa
ttgcagaagaagaaagaggagctgaatgcagtgcgcaggcaagctgagggcttgtctgag
aatggggccgcaatggcagtggagccaactcagatccagctcagcaagcgctggcggcaa
attgagagcaattttgctcagtttcgaagactcaactttgcacaaattcacactctccat
gaagaaactatggtagtgacgactgaagatatgcctttggatgtttcttatgtgccttct
acttatttgaccgagatcagtcatatcttacaagctctttcagaagttgatcatcttcta
aatactcctgaactctgtgctaaagattttgaagatctttttaagcaagaggagtctctt
aagaatataaaagacaatttgcaacaaatctcaggtcggattgatattattcacaagaag
aagacagcagccttgcaaagtgccacctccatggaaaaggtgaaagtacaggaagccgtg
gcacagatggatttccagggggaaaaacttcatagaatgtacaaggaacgacaagggcga
ttcgacagatcagttgaaaaatggcgacactttcattatgatatgaaggtatttaatcaa
tggctgaatgaagttgaacagtttttcaaaaagacacaaaatcctgaaaactgggaacat
gctaaatacaaatggtatcttaaggaactccaggatggcattgggcagcgtcaagctgtt
gtcagaacactgaatgcaactggggaagaaataattcaacagtcttcaaaaacagatgtc
aatattctacaagaaaaattaggaagcttgagtctgcggtggcacgacatctgcaaagag
ctggcagaaaggagaaagaggattgaagaacaaaagaatgtcttgtcagaatttcaaaga
gatttaaatgaatttgttttgtggctggaagaagcagataacattgctattactccactt
ggagatgagcagcagctaaaagaacaacttgaacaagtcaagttactggcagaagagttg
cccctgcgccagggaattctaaaacaattaaatgaaacaggaggagcagtacttgtaagt
gctcccataaggccagaagagcaagataaacttgaaaagaagctcaaacagacaaatctc
cagtggataaaggtctccagagctttacctgagaaacaaggagagcttgaggttcactta
aaagattttaggcagcttgaagagcagctggatcacctgcttctgtggctctctcctatt
agaaaccagttggaaatttataaccaaccaagtcaggcaggaccgtttgacataaaggag
attgaagtaacagttcacggtaaacaagcggatgtggaaaggcttttgtcgaaagggcag
catttgtataaggaaaaaccaagcactcagccagtgaagaggaagttagaagatctgagg
tctgagtgggaggctgtaaaccatttacttcgggagctgaggacaaagcagcctgaccgt
gcccctggactgagcactactggagcctctgccagtcagactgttactctagtgacacaa
tctgtggttactaaggaaactgtcatctccaaactagaaatgccatcttctttgctgttg
gaggtacctgcactggcagacttcaaccgagcttggacagaacttacagactggctgtct
ctgcttgatcgagttataaaatcacagagagtgatggtgggtgatctggaagacatcaat
gaaatgatcatcaaacagaaggcaacactgcaagatttggaacagagacgcccccaattg
gaagaactcattactgctgcccagaatttgaaaaacaaaaccagcaatcaagaagctaga
acaatcattactgatcgaattgaaagaattcagattcagtgggatgaggttcaagaacag
ctgcagaacaggagacaacagttgaatgaaatgttaaaggattcaacacaatggctggaa
gctaaggaagaagccgaacaggtcataggacaggtcagaggcaagcttgactcatggaaa
gaaggtcctcacacagtagatgcaatccaaaagaagatcacagaaaccaagcagttggcc
aaagacctccgtcaacggcagataagtgtagacgtggcaaatgatttggcactgaaactt
cttcgggactattctgctgatgataccagaaaagtacacatgataacagagaatatcaat
acttcttggggaaacattcataaaagagtaagtgagcaagaggctgctttggaagaaact
catagattactgcagcagttccctctggacctggagaagtttctttcctggattacggaa
gcagaaacaactgccaatgtcctacaggacgcttcccgtaaggagaagctcctagaagac
tccaggggagtcagagagctgatgaaaccatggcaagatctccaaggagaaattgaaact
cacacagatatctatcacaatcttgatgaaaatggccaaaaaatcctgagatccctggaa
ggttcggatgaagcacccctgttacaaagacgtttggataacatgaatttcaagtggagt
gaacttcagaaaaagtctctcaacattaggtcccatttggaagcaagttctgaccagtgg
aagcgtttgcatctttctcttcaggaacttcttgtttggctacagctgaaagatgatgaa
ctgagccgtcaggcacccatcggtggtgatttcccagcagttcagaagcagaatgatata
catagggccttcaagagggaattgaaaactaaagaacctgtaatcatgagtactctggag
actgtgagaatatttctgacagagcagcctttggaaggactagagaaactctaccaggag
cccagagaactgcctcctgaagaaagagctcagaatgtcactcggctcctacgaaagcag
gctgaagaggtcaacgctgaatgggacaaattgaacctgcgctcagctgattggcagaga
aaaatagatgaagctcttgaaagactccaggaacttcaggaagctgccgatgaactggac
ctcaagttgcgccaagctgaggtgatcaagggatcctggcagccagtgggggatctcctc
attgactctctgcaagatcaccttgaaaaagtcaaggcacttcggggagaaattgcacct
cttaaagagaatgtcaatcgtgtcaatgaccttgcacatcagctgaccacactgggcatt
cagctctcaccttataacctcagcactttggaagatctgaataccagatggaggcttcta
caggtggctgtggaggaccgtgtcagacagctgcatgaagcccacagggactttggtcct
gcatcccagcacttcctttccacttcagttcagggtccctgggagagagccatctcacca
aacaaagtgccctactatatcaaccacgagacccaaaccacttgttgggaccaccccaaa
atgacagagctctaccagtctttagctgacctgaataatgtcaggttctccgcgtatagg
actgccatgaagctcagaaggctccagaaggccctttgcttggatctcttgagcctgtca
gctgcatgtgatgccctggaccagcacaacctcaagcaaaatgaccagcccatggatatc
ctgcagataattaactgtttgactacaatttatgatcgtctggagcaagagcacaacaat
ctggtcaatgtccctctctgtgtggatatgtgtctcaactggcttctcaatgtttatgat
acgggacgaacagggaggatccgtgtcctgtcttttaaaactggcatcatttctctgtgt
aaagcacacttggaagacaagtacagataccttttcaagcaagtggcaagttcaactggc
ttttgtgaccagcgtaggctgggtcttcttctgcatgattctattcaaatcccaagacag
ttgggtgaagttgcttcctttgggggcagtaacattgagccgagtgtcaggagctgcttc
caatttgccaataataaacctgagattgaagctgctctcttccttgactggatgcgcctg
gaaccccagtctatggtgtggctgcccgtcttgcacagagtggctgctgctgaaactgcc
aagcatcaagccaagtgtaacatctgtaaggagtgtccaatcattggattcaggtacaga
agcctaaagcattttaattatgacatctgccaaagttgctttttttctggccgagttgca
aagggccataaaatgcactaccccatggtagagtattgcactccgactacatccggagaa
gatgttcgcgacttcgccaaggtactaaaaaacaaatttcgaaccaaaaggtattttgcg
aagcatccccgaatgggctacctgccagtgcagactgtgttagagggggacaacatggaa
actcccgttactctgatcaacttctggccagtagattctgcgcctgcctcgtccccccag
ctttcacacgatgatactcattcacgcattgaacattatgctagcaggctagcagaaatg
gaaaacagcaatggatcttatctaaatgatagcatctctcctaatgagagcatagatgat
gaacatttgttaatccagcattactgccaaagtttgaaccaggactcccccctgagccag
cctcgtagtcctgcccagatcttgatttccttagagagtgaggaaagaggggagctagag
agaatcctagcagatcttgaggaagaaaacaggaatctgcaagcagaatatgatcgcctg
aagcagcagcatgagcataaaggcctgtctccactgccatctcctcctgagatgatgccc
acctctcctcagagtcccagggatgctgagctcattgctgaggctaagctactgcgccaa
cacaaaggacgcctggaagccaggatgcaaatcctggaagaccacaataaacagctggag
tctcagttacatagactgagacagctcctggagcagccccaggctgaagctaaggtgaat
ggcaccacggtgtcctctccttccacctctctgcagaggtcagatagcagtcagcctatg
ctgctccgagtggttggcagtcaaacttcagaatctatgggtgaggaagatcttctgagt
cctccccaggacacaagcacagggttagaagaagtgatggagcaactcaacaactccttc
cctagttcaagaggaagaaatgcccccggaaagccaatgagagaggacacaatgtag

DBGET integrated database retrieval system