KEGG   Mus musculus (mouse): 13856Help
Entry
13856             CDS       T01002                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    13856 (Epo)
   04066 HIF-1 signaling pathway
    13856 (Epo)
   04151 PI3K-Akt signaling pathway
    13856 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13856 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    13856 (Epo)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    13856 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13856 (Epo)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   13856 (Epo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 13856
NCBI-ProteinID: NP_031968
MGI: 95407
Ensembl: ENSMUSG00000029711
Vega: OTTMUSG00000021944
UniProt: P07321 Q0VED9
LinkDB All DBs
Position
5 G2; 5 76.5 cM
AA seq 192 aa AA seqDB search
MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPR
LSENITVPDTKVNFYAWKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLH
IDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKLK
LYTGEVCRRGDR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccaccctgctgcttttactctccttgctactgattcctctg
ggcctcccagtcctctgtgctcccccacgcctcatctgcgacagtcgagttctggagagg
tacatcttagaggccaaggaggcagaaaatgtcacgatgggttgtgcagaaggtcccaga
ctgagtgaaaatattacagtcccagataccaaagtcaacttctatgcttggaaaagaatg
gaggtggaagaacaggccatagaagtttggcaaggcctgtccctgctctcagaagccatc
ctgcaggcccaggccctgctagccaattcctcccagccaccagagacccttcagcttcat
atagacaaagccatcagtggtctacgtagcctcacttcactgcttcgggtactgggagct
cagaaggaattgatgtcgcctccagataccaccccacctgctccactccgaacactcaca
gtggatactttctgcaagctcttccgggtctacgccaacttcctccgggggaaactgaag
ctgtacacgggagaggtctgcaggagaggggacaggtga

DBGET integrated database retrieval system