KEGG   Mus musculus (house mouse): 14000
Entry
14000             CDS       T01002                                 
Symbol
Drosha, 1110013A17Rik, AI874853, Etohi2, Rn3, Rnasen
Name
(RefSeq) drosha, ribonuclease type III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    14000 (Drosha)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    14000 (Drosha)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    14000 (Drosha)
   03009 Ribosome biogenesis [BR:mmu03009]
    14000 (Drosha)
   03036 Chromosome and associated proteins [BR:mmu03036]
    14000 (Drosha)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     14000 (Drosha)
Messenger RNA biogenesis [BR:mmu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     14000 (Drosha)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   RNase
    14000 (Drosha)
 Prokaryotic type
  rRNA processing factors
   14000 (Drosha)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     14000 (Drosha)
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm
Other DBs
NCBI-GeneID: 14000
NCBI-ProteinID: NP_001123621
MGI: 1261425
Ensembl: ENSMUSG00000022191
Vega: OTTMUSG00000023663
UniProt: Q5HZJ0
LinkDB
Position
15:12824893..12935377
AA seq 1373 aa
MQGNTCHRMSYHPGRGCPRGRGGHGARPSAPAFRPQNLRLLHPQQPPAQYQYEPPSAPSS
SYSNSQAPSFMPPRPDFVPYPPPAAPSAQGPLPPCPVRPPYPNHQMRHPFPVPPCFPPMP
PPMPCPNNPPASGAPPGQGTFPFMVPPPSMPHPPPPPVMPQQVNYQYPPGYSHSFPPPGF
NSYQNNSSSFPPSANSSSTPHFRHLPPYSLPKAQNERRSPERLKHYDDHRHRDHSHGRGE
RHRSLERRERGRSPERRRPESRYRSDYDRGRTPPPRHRSYERSRERDRERHRHREARRSP
SLERSYKKEYKRSGRSYALPVAPEPAGCTPELPGEMIKTTESWAPPPENVNHRSPSREKK
RARWEEEKDRWSDSQGSGKEKNYTSIKEKEAEEVPPEKTEEEEEELLKPVWIRCTHSESY
YSSDPMDQVGDSTVVGTSRLRDLYDKFEEELGNRQEKAKAARPPWEPPKTKLDEDLESSS
ESECETDDDSTCSSSSDSEVFDVIAEIKRKKAHPDRLHDELWYNDPGQMNDGPLCKCSAK
ARRTGIRHSIYPGEEAIKPCRPMTNNAGRLFHYRITVSPPTNFLTDRPTVIEYDDHEYIF
EGFSMFAHAPLTNIPLCKVIRFNIDYTIHFIEEMMPENFCVKGLELFSLFLFRDILELYD
WNLKGPLFEDSPPCCPRFHFMPRFVRFLPDGGKEVLSMHQILLYLLRCSKALVPEEEIAN
MLQWEELEWQKYAEECKGMIVTNPGTKPSSVRIDQLDREQFNPEVITFPIIVHFGIRPAQ
LSYAGDPQYQKLWKSYVKLRHLLANSPKVKQTDKQKLAQREEALQKIRQKNTMRREVTVE
LSSQGFWKTGIRSDVCQHAMMLPVLTHHIRYHQCLMHLDKLIGYTFQDRCLLQLAMTHPS
HHLNFGMNPDHARNSLSNCGIRQPKYGDRKVHHMHMRKKGINTLINIMSRLGQDDPTPSR
INHNERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRF
MLYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWLNY
PLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTLG
HNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYAI
TNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQDWNDP
KSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQAE
MGAAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPEEAEDIKK
NT seq 4122 nt   +upstreamnt  +downstreamnt
atgcaaggcaatacgtgtcatagaatgtcgtaccacccaggacgagggtgtccccggggc
cgaggaggacacggagccagaccttcagcaccagctttcagaccccaaaacctgcgactt
cttcatccccagcagccgcctgcgcagtatcaatatgagcctccgagcgccccctcttcc
tcctactcgaactctcaggcccccagctttatgcccccacggccagactttgtcccttac
cctcccccagcggcgccgtctgcccaagggcctctccctccctgcccagtgaggccgcct
taccccaaccaccagatgagacaccctttcccggtgcctccctgttttccacccatgccc
cctccgatgccttgtcccaataacccgcctgcctccggagcacctcccggacaaggcact
ttccccttcatggtgccccctccttccatgccccaccctccgcccccgcccgtcatgccg
cagcaggttaattaccagtacccccctgggtactcgcacagcttcccaccgcccggcttc
aacagttaccagaacaactccagctctttcccacccagtgctaacagcagcagcactcct
cattttcgacacctcccaccatactcactcccaaaggctcagaatgagaggcggtcccca
gaaaggctcaagcactacgacgaccacaggcaccgagatcacagtcacgggcgaggcgag
aggcatcggtccctggagcgcagggagcgcggccgcagccctgaaaggagaagacctgag
agccgctaccgctcagactatgatcgggggagaacgccaccgcctcgccaccgcagctat
gaaaggagcagagagcgggatcgagagagacacaggcaccgggaggcccgcagatcaccg
tctctagaaaggtcctacaagaaagagtataagagatctggaaggagttacgctttacca
gttgctcctgagcccgctgggtgcacaccagagttgcctggggagatgattaaaactaca
gagtcttgggccccgcccccggagaatgtgaatcatcgttctccaagcagggagaagaag
agagctcgttgggaggaggaaaaagacagatggagcgacagccagggctctggcaaagag
aagaactacacgtccatcaaagagaaagaggcagaggaggtgcctccagagaagacggag
gaggaggaggaagagctccttaagcctgtgtggattcgctgtacacattcggaaagctat
tactccagtgacccaatggatcaggtgggagactcgactgtcgtagggacaagcaggctc
cgtgatttgtatgacaaatttgaggaagaattggggaataggcaagagaaggccaaagct
gcccggcctccgtgggagcctccgaagacaaagctggatgaagatttagagagttccagt
gagtctgaatgtgagactgacgacgacagcacctgttcgagcagctcggactcggaggtg
ttcgatgtcattgcagagattaaacgcaaaaaggctcaccctgaccggcttcatgatgaa
ctctggtacaacgacccaggccagatgaacgatggaccgctttgcaaatgcagtgcaaaa
gccagacgcacaggaatccgccacagcatttatcccggagaagaggcaatcaagccctgc
cgtccgatgaccaacaacgctggccggcttttccactatcggatcaccgtctccccgcct
accaacttcttaactgacaggccaacagtcatagaatatgatgaccacgagtatattttt
gaaggattttctatgtttgcacatgctcctctgaccaatattccactgtgtaaagtgatt
cgattcaacatagactacacgattcattttatcgaagagatgatgcctgagaatttttgt
gtgaaaggacttgaactgttttcattgttcctattcagagatattttggaattatatgac
tggaatcttaaaggtcctttgtttgaagacagccctccctgctgtccgagatttcatttc
atgccacgttttgtaagatttcttccagatggaggcaaagaagtgttatccatgcaccag
atccttctctacctgctgcgctgcagcaaggctctggtgcccgaggaggagattgccaac
atgctccagtgggaggagctcgagtggcagaaatacgcagaggagtgcaaaggcatgatc
gttaccaaccctgggacgaaaccgagctctgtccgcattgatcagctggatcgtgaacag
ttcaaccccgaagtgatcactttcccgattatcgttcactttgggatccgccccgcacag
ttgagttatgcaggagacccacagtatcagaaattatggaaaagctatgtgaaacttcgc
cacctcctagcaaacagtcccaaagtcaaacaaactgacaagcagaagctggctcagagg
gaggaagcgctccagaaaatacggcagaagaacacgatgcggcgagaagtcaccgtggag
ctgagtagccaaggattctggaaaactggcattcgttctgatgtctgtcagcatgcaatg
atgctgcctgttctgacccatcacatccggtaccatcaatgcttaatgcacctggacaag
ttgataggatatactttccaagaccgttgtctgctccagcttgccatgactcatccgagt
caccatttaaattttggaatgaatcctgaccatgccaggaattctttgtctaactgtgga
attcgacaacccaaatatggagacagaaaagttcatcacatgcacatgcggaaaaaagga
attaataccctaataaatatcatgtcacgccttggccaagatgatccaactccttcaagg
attaatcacaacgaaaggttggagttcctgggggatgctgttgttgagtttctgaccagt
gtccacctgtactacctgtttcctagcttggaggaagggggcttggcgacctatcggacc
gccattgttcagaatcagcacctcgccatgcttgcaaagaaacttgaactggatcgattt
atgctatatgcccatgggcccgacctatgtagagaatcagatctccgccatgcgatggcc
aattgttttgaagccttgataggagctgtttacttggaggggagcctagaggaagccaaa
cagttatttggacgcttactctttaatgatccggaccttcgagaagtctggctcaattat
cctctccacccactccaactacaagagccaaatacggatcggcaacttattgaaacttcc
ccagttctacagaaacttacggagtttgaagaagcaattggagtgatcttcactcacgtc
cggcttctggcgagggcgttcacactgagaaccgtgggctttaaccacctgaccctaggc
cacaatcagaggatggaatttctgggcgactccataatgcagctggtggccacagagtac
ttgttcattcatttcccggaccatcacgaaggacacttgacgttgttacgaagttcctta
gtgaacaacagaacgcaagccaaggtagcagaggaactgggcatgcaggagtatgccatc
accaacgacaaaaccaagagacccgtggccctaagaaccaagactttggcagaccttttg
gaatcatttatcgcagcgctgtacatcgacaaggacctggaatatgtccacactttcatg
aacgtctgcttctttccccggctgaaggagttcattctgaatcaggattggaacgacccc
aagtcgcagctgcagcagtgttgtctgaccctgaggacagaagggaaagagcctgacatc
cccttatacaagactctgcagacagtggggccatcccatgctagaacctacactgtggct
gtttatttcaagggagaaaggataggctgtgggaaaggaccaagcattcagcaggcggag
atgggagcagcaatggatgcactggagaaatataactttccccagatggcccatcagaag
cggttcattgagcggaaatacagacaagagttaaaggaaatgaggtgggaaagagagcat
caggagagagagccggaggaggctgaagacatcaagaagtaa

DBGET integrated database retrieval system