KEGG   Mus musculus (mouse): 14268Help
Entry
14268             CDS       T01002                                 

Gene name
Fn1, E330027I09, Fn, Fn-1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05100  Bacterial invasion of epithelial cells
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    14268 (Fn1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    14268 (Fn1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14268 (Fn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14268 (Fn1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    14268 (Fn1)
   05205 Proteoglycans in cancer
    14268 (Fn1)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    14268 (Fn1)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    14268 (Fn1)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    14268 (Fn1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    14268 (Fn1)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    14268 (Fn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14268 (Fn1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14268 (Fn1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14268 (Fn1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    14268 (Fn1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   14268 (Fn1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   14268 (Fn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF4959 DUF4912 MG4
Motif
Other DBs
NCBI-GeneID: 14268
NCBI-ProteinID: NP_034363
MGI: 95566
Ensembl: ENSMUSG00000026193
Vega: OTTMUSG00000048807
UniProt: P11276 Q3UZF9
LinkDB All DBs
Structure
PDB: 

Position
1 C3; 1 36.05 cM
AA seq 2477 aa AA seqDB search
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKPGCFDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYKVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAGSGSFTDVRTAIYQPQTHP
QPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGNSNGALC
HFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKFVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRPKTSTGRWKEATIP
GHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTRFDFTTSASTPVTSNTVTGETAPYSPV
VATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL
PGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGT
PRSDNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTF
AEITGLSPGVTYLFKVFAVHQGRESNPLTAQQTTKLDAPTNLQFVNETDRTVLVTWTPPR
ARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEYTVTLVAVKGNQQSPKATGV
FTTLQPLRSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYTYTIQVLRDGQERDAPIVNRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISD
TVVPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVG
YYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPP
PSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIPL
RGRQKTGLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSR
NSITLTNLNPGTEYVVSIIAVNGREESPPLIGQQATVSDIPRDLEVIASTPTSLLISWEP
PAVSVRYYRITYGETGGNSPVQEFTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPAS
SKPVSINYKTEIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTA
SPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKI
AWESPQGQVSRYRVTYSSPEDGIRELFPAPDGEDDTAELQGLRPGSEYTVSVVALHDDME
SQPLIGIQSTAIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINL
SPDSSSVIVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENVSPPRRARVTDATETTI
TISWRTKTETITGFQVDAIPANGQTPVQRSISPDVRSYTITGLQPGTDYKIHLYTLNDNA
RSSPVIIDASTAIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPR
PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEI
LDVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPVR
LRPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESS
EYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTV
GNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKW
CHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK
EYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPI
ECFMPLDVQADRDDSRE
NT seq 7434 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggggtccgggacccgggcggctgctgctgctggcagtcctgtgcctggggacc
tcggtgcgctgcaccgaagccgggaagagcaagaggcaggctcagcaaatcgtgcagcct
caatccccggtggctgtcagtcagagcaagcctggctgttttgacaatgggaagcactat
cagataaatcagcagtgggaacggacctacctaggcaacgccctggtttgtacctgctat
ggaggaagccggggttttaactgcgagagcaagcctgagcctgaagagacttgctttgac
aaatacactgggaacacttacaaagtgggtgacacttatgagcgccctaaagattccatg
atctgggactgtacctgcatcggggctgggagaggcaggatcagctgtaccattgcaaat
cgctgccatgaagggggtcagtcctacaagattggcgacaagtggaggaggccacatgag
actggtggctacatgttagagtgtctgtgtctgggaaatggaaaaggggaatggacctgc
aaacctatagctgagaagtgttttgatcatgctgctgggacgtcctacgtcgtgggggag
acctgggaaaagccctaccaaggctggatgatggtggactgtacttgtctaggcgaaggc
aatggacgcatcacctgtacctccagaaacagatgcaacgatcaggacacccggacatcc
tataggattggagacacgtggagcaagaaggacaaccgaggaaacctgcttcagtgtgtc
tgcacaggcaatggcagaggggagtggaagtgtgagcgacatgctctacaaagtgcttca
gccggatctggctccttcactgatgtccgaacagctatttaccaaccgcagactcacccc
cagcccgctccctacggccactgtgtcaccgacagtggtgtggtctactctgtgggaatg
cagtggctgaagtcgcaaggaaacaagcaaatgctgtgcacgtgcctgggcaatggcgtc
agctgccaggagacagccgtgacccagacttatggtggcaattcaaacggggagccctgt
gtcctcccgttcacctacaacggtaggaccttctattcctgcaccaccgaagggcggcaa
gacggacatctgtggtgtagcacaacttccaattacgaacaagaccagaagtattccttc
tgcacagaccatgcggttttggttcagactcgaggcggaaattccaatggtgctctgtgc
cacttccccttcctgtacaacaaccggaattacaccgactgtacttctgagggtcgcagg
gacaacatgaaatggtgcggcaccacccagaactacgatgccgatcagaagtttggattc
tgcccaatggctgcccacgaggagatctgcacaaccaatgaaggggtcatgtatcgcatt
ggggatcagtgggataagcagcatgacctgggccacatgatgaggtgcacgtgtgtgggg
aacggtcgtggagaatgggcctgcatcccctactcccagctccgagaccagtgcatcgtt
gatgacattacttacaatgtgaacgacacgttccacaagcgtcacgaggagggacatatg
ctgaactgtacctgctttggtcagggccggggcagatggaagtgtgaccccattgaccag
tgccaagattcagagacccggacattttaccagattggtgactcctgggagaagtttgtg
catggtgtccgataccagtgttactgctacggccgtggcatcggggagtggcactgtcaa
cctctgcagacctacccaggcacaactggacctgtccaagtaattatcacggagaccccc
agccagcccaattcccaccccatccagtggaatgccccggagccttcacacatcaccaag
tacattctcagatggagacctaaaacctctacgggtcgctggaaggaagctaccattcct
ggccaccttaactcctataccatcaaaggcctgaccccaggtgtgatctatgagggacag
ctcatcagcatccagcagtatggccacagagaagtgacacgcttcgacttcaccaccagc
gccagcacccctgtgaccagcaacacggtgaccggagagactgcgccctactctcctgtt
gtggccacttctgaatctgtaactgaaatcacagccagcagctttgtggtctcatgggtc
tcagcctccgacaccgtgtcaggcttccgggtggagtatgagctgagcgaggagggagat
gaaccacagtaccttgatctcccaagcacggccacttccgtgaacattcctgacctgctc
ccgggcagaaagtacattgtcaatgtctatcagatatctgaggagggaaaacagagcttg
atcctgtctacctcacagactacagcacctgacgctcctccagaccctaccgtggaccag
gttgatgatacttccattgttgttcggtggagtagaccccaggcacctatcacagggtat
agaattgtctattcaccttcagtagaaggcagtagcacagagctcaacctccctgaaacg
gccaactccgtcaccctcagcgacctgcagcccggtgttcagtacaacatcactatctat
gctgtggaggagaaccaggagagcacacccgttttcatccaacaagagaccactggcacc
ccaagatctgataacgtcccccctccgacggacctacagtttgtggaactgactgatgtg
aaagtcaccatcatgtggacccctcctgatagtgtggtgtctggataccgtgtggaggtc
ctgcctgtcagcctgcccggggaacatgggcagaggctgcctgtcaacagaaataccttt
gctgaaatcactgggctgtcccctggggtcacgtacctcttcaaagtctttgctgtgcac
cagggcagggaaagcaatcctctgacggcacaacagaccaccaaactcgacgctcccact
aacctccagtttgtcaatgaaactgacagaacagttctggtaacgtggactccacctcga
gcccgtatagcaggctaccgactgaccgcgggcctgacccgaggaggccagcccaagcag
tacaatgtgggacccttggcctccaagtatcccctgagaaatctgcagcctgggtctgag
tacaccgtgaccttggtggctgtgaaagggaaccagcagagtcccaaagccaccggagtc
tttactaccctgcagcctctgcgctccattccaccttacaacaccgaggtgacagagacc
acaattgtgatcacctggacccccgctccaaggattggcttcaagctgggtgtacgaccg
agccagggaggtgaggcaccccgagaagtgacttcagactctgggagcattgttgtgtct
ggcttgactccaggcgtggaatacacttacaccatccaagtcctgcgagatggccaggag
agagatgcaccgattgtcaacagagtagtgacaccgctgtctccaccgaccaacttgcat
ctggaggcaaaccctgacactggagtgcttactgtctcctgggagaggagcactacccca
gatatcactggctacagaataactactacccccacgaacgggcagcaggggacctctctg
gaagaagtggtccatgctgatcagagttcctgcacttttgagaacctgaatcctggcctg
gagtacaacgtcagtgtttacactgtcaaagatgacaaggaaagtgcccctatctctgat
accgttgtcccagaggtgccccagctcactgacctaagctttgttgatataactgattca
agcatcggcctgaggtggaccccgctaaactcttccaccattatcgggtaccgaatcaca
gtagttgcggcaggagaagggatccctatttttgaagattttgtggactcctcagtagga
tactacacagttacagggctggagcctggcattgactatgacatcagcgttatcactctc
attaatggcggagagagtgcccctactacactgacacagcaaacggctgtccctcctccc
acggatctgcgattcaccaatatcggtccagacacgatgcgggtcacttgggccccgcct
ccgtccatcgagctgaccaacctcttggtgcgctactcacccgtgaagaatgaagaggac
gttgcagagctatccatttcaccttcagacaatgccgtggtcctaacaaatctcctgcct
gggacagaatacttagtcagtgtctccagtgtctacgaacaacatgagagcatccctctc
cggggaaggcagaaaacaggtctcgattccccaactggttttgattcttctgatatcacc
gccaactcattcactgtccactgggtggctcctcgggcccccatcaccggctacatcatc
cgccatcacgccgagcattctgtcggaagacccaggcaggatcgagtgccgccctcgcgg
aattccatcaccctcaccaaccttaatccgggcaccgagtacgttgtcagcatcattgct
gttaatggcagagaggagagcccgccactgattggccagcaagccacagtttctgatatt
ccgagagatctggaggtcattgcctccacccccaccagcctgctcatcagttgggaaccc
cctgccgtctctgtgcgctattacagaatcacctacggagagacaggaggaaatagccct
gtccaggagttcactgtgcccggaagcaagtccacagccaccatcaacaacattaaacca
ggagcagactacaccatcaccctgtatgctgtcactggccgtggggacagtccagcaagc
agcaagccagtttccatcaattataaaacagaaattgacaagccgtcccagatgcaggtg
acagatgtccaggacaacagcatcagtgtcaggtggctgccttcaacttctcctgtgaca
ggctacagagtgaccaccactcccaaaaatggcctaggaccatcaaaaactaaaactgcc
agtccagatcaaacagaaatgaccattgaaggtttgcaacccactgtggagtacgtggtt
agtgtttatgctcagaaccggaacggagaaagccagcccctggttcaaactgcagtgacc
aacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaaatt
gcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccctgag
gatggaatccgggagcttttccctgcacctgatggtgaagacgacactgcagagctgcag
ggcctcaggccggggtctgagtacacagtcagtgtggttgccttgcacgatgatatggag
agccagcccctgattggaatccagtccacagccattcctgcgcccaccaatctgaagttc
agtcaggtgacacccaccagctttactgcccagtggatagcacccagtgttcagctcact
ggctaccgggtgcgggtgaacccgaaagagaagacaggaccaatgaaagaaatcaacctt
tctccagacagctcatcggtgattgtgtcaggactcatggtggccactaaatacgaagtc
agtgtctatgctctcaaggacacactgacaagcagaccagcccagggagtcatcactact
ctggagaatgttagccctccaagaagggcccgtgtgacggacgctacagagaccaccatc
actattagctggagaacaaagacagagacaatcactggcttccaagtcgatgccatccca
gccaatggccagaccccagttcagaggagcatcagcccggatgttagaagctacaccatt
acaggtttacagccaggcactgactacaagatccacctgtacactctgaacgacaatgcc
cggagctcgcccgtgatcatcgatgcctccaccgccatcgacgcaccatccaacctgcgg
ttcctgaccaccacacccaactccttgctggtgtcatggcaggcgccccgtgccaggatt
actggctacattatcaagtatgagaagcctggatcccctcccagagaagtggtccctcgg
ccccgccctggtgtcacggaggccaccattactggtctggagccaggaaccgagtacacc
atctacgtcattgccctgaagaacaatcagaagagtgagcccctgattgggaggaagaag
acagatgagcttccccaactggttacccttccacaccccaatcttcatggaccagagatc
ttggatgttccctccacagttcaaaagacccccttcatcaccaaccctgggtatgacacc
gaaaatggtattcagcttcctggcacaacccaccagcaacccagtgttgggcaacaaatg
atctttgaggaacatggctttaggcggacaacgccacccactgcggccacccccgtcagg
cttaggccaagaccatacctgccgaatgtagatgaggaggtccaaatcggtcatgttccc
aggggagacgtagactaccacctctatcctcatgttccgggcctcaatccaaatgcctct
acaggacaggaagctctctctcagacaaccatctcttggacgccgttccaggagagttct
gagtacatcatttcatgccaaccagttggcaccgacgaagagcccttacagttccaagtt
cctggaacttctaccagtgcgactctgactggccttaccagaggggtcacctacaacatc
atagtggaggcactgcagaaccagaggaggcacaaggttcgggaagaggttgtgactgtg
ggcaacgctgtcagcgaaggcctgaaccagcctacagatgactcatgctttgacccttac
acggtttcccattacgccattggagaggagtgggagcggttgtctgacgctggctttaag
ctcacatgccagtgcttgggctttggcagtggtcatttcagatgcgattcatctaaatgg
tgccatgacaacggtgtcaactacaagatcggagagaagtgggatcggcagggagaaaat
ggccagcggatgagctgcacatgcctcgggaatggaaagggagaattcaagtgtgatccc
catgaagcaacgtgctatgacgatgggaagacctaccatgtaggagaacagtggcagaaa
gaatatctcggagccatttgctcctgcacgtgtttcggaggccagcggggctggcgctgt
gacaactgccgtagacctggggctgctgaacccagtcccgatggcaccaccggccacacc
tacaaccagtatacacagagatacaatcagagaacaaacactaacgtaaattgccccatt
gagtgcttcatgccgctagatgtgcaagctgacagagacgattctcgagagtaa

DBGET integrated database retrieval system