KEGG   Mus musculus (house mouse): 14663
Entry
14663             CDS       T01002                                 
Symbol
Glycam1, MC26, Sgp50, glyCAM-1
Name
(RefSeq) glycosylation dependent cell adhesion molecule 1
  KO
K06815  glycosylation dependent cell adhesion molecule 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14663 (Glycam1)
SSDB
Motif
Pfam: GLYCAM-1 Ndc1_Nup Tropomyosin_1
Other DBs
NCBI-GeneID: 14663
NCBI-ProteinID: NP_032160
MGI: 95759
Ensembl: ENSMUSG00000022491
UniProt: Q02596
LinkDB
Position
15:complement(103471186..103473508)
AA seq 151 aa
MKFFTVLLFVSLAATSLALLPGSKDELQMKTQPTDAIPAAQSTPTSYTSEESTSSKDLSK
EPSIFREELISKDNVVIESTKPENQEAQDGLRSGSSQLEETTRPTTSAATTSEENLTKSS
QTVEEELGKIIEGFVTGAEDIISGASRITKS
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaattcttcactgtcctgctatttgtcagtcttgctgccacctctcttgctctcctg
cctgggtccaaagatgaacttcaaatgaagactcagcccacagatgccattccagctgcc
cagtccactcccaccagctacaccagtgaggagagtacttccagtaaggacctttccaag
gagccttccatcttcagagaagagctgatttccaaagataatgtggtgatagaatctacc
aagccagagaatcaagaggcccaggatgggctcaggagcgggtcatctcagctggaagag
accacaagacccaccacctcagctgcaaccacctcagaggaaaatctgaccaagtcaagc
cagacagtggaggaagaactgggtaaaataattgaaggatttgtaactggtgcagaagac
ataatctctggtgccagtcgtatcacgaagtcatga

DBGET integrated database retrieval system