Mus musculus (house mouse): 14679 Help Entry 14679             CDS       T01002                                  Symbol Gnai3, Galphai3, Gnai-3, Hg1a Name (RefSeq) G protein subunit alpha i3   KO K04630   guanine nucleotide-binding protein G(i) subunit alpha Organism mmu  Mus musculus (house mouse) Pathway mmu04015   Rap1 signaling pathway mmu04022   cGMP-PKG signaling pathway mmu04024   cAMP signaling pathway mmu04062   Chemokine signaling pathway mmu04071   Sphingolipid signaling pathway mmu04081   Hormone signaling mmu04082   Neuroactive ligand signaling mmu04261   Adrenergic signaling in cardiomyocytes mmu04360   Axon guidance mmu04371   Apelin signaling pathway mmu04540   Gap junction mmu04611   Platelet activation mmu04670   Leukocyte transendothelial migration mmu04713   Circadian entrainment mmu04723   Retrograde endocannabinoid signaling mmu04724   Glutamatergic synapse mmu04725   Cholinergic synapse mmu04726   Serotonergic synapse mmu04727   GABAergic synapse mmu04728   Dopaminergic synapse mmu04730   Long-term depression mmu04914   Progesterone-mediated oocyte maturation mmu04915   Estrogen signaling pathway mmu04916   Melanogenesis mmu04921   Oxytocin signaling pathway mmu04923   Regulation of lipolysis in adipocytes mmu04924   Renin secretion mmu04926   Relaxin signaling pathway mmu04928   Parathyroid hormone synthesis, secretion and action mmu04934   Cushing syndrome mmu04935   Growth hormone synthesis, secretion and action mmu04971   Gastric acid secretion mmu05012   Parkinson disease mmu05030   Cocaine addiction mmu05032   Morphine addiction mmu05034   Alcoholism mmu05133   Pertussis mmu05142   Chagas disease mmu05145   Toxoplasmosis mmu05163   Human cytomegalovirus infection mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer mmu05207   Chemical carcinogenesis - receptor activation Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     14679 (Gnai3)    04371 Apelin signaling pathway     14679 (Gnai3)    04071 Sphingolipid signaling pathway     14679 (Gnai3)    04024 cAMP signaling pathway     14679 (Gnai3)    04022 cGMP-PKG signaling pathway     14679 (Gnai3)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     14679 (Gnai3)    04081 Hormone signaling     14679 (Gnai3)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     14679 (Gnai3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     14679 (Gnai3)    04670 Leukocyte transendothelial migration     14679 (Gnai3)    04062 Chemokine signaling pathway     14679 (Gnai3)   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     14679 (Gnai3)    04915 Estrogen signaling pathway     14679 (Gnai3)    04914 Progesterone-mediated oocyte maturation     14679 (Gnai3)    04921 Oxytocin signaling pathway     14679 (Gnai3)    04926 Relaxin signaling pathway     14679 (Gnai3)    04935 Growth hormone synthesis, secretion and action     14679 (Gnai3)    04928 Parathyroid hormone synthesis, secretion and action     14679 (Gnai3)    04916 Melanogenesis     14679 (Gnai3)    04924 Renin secretion     14679 (Gnai3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     14679 (Gnai3)   09154 Digestive system    04971 Gastric acid secretion     14679 (Gnai3)   09156 Nervous system    04724 Glutamatergic synapse     14679 (Gnai3)    04727 GABAergic synapse     14679 (Gnai3)    04725 Cholinergic synapse     14679 (Gnai3)    04728 Dopaminergic synapse     14679 (Gnai3)    04726 Serotonergic synapse     14679 (Gnai3)    04730 Long-term depression     14679 (Gnai3)    04723 Retrograde endocannabinoid signaling     14679 (Gnai3)   09158 Development and regeneration    04360 Axon guidance     14679 (Gnai3)   09159 Environmental adaptation    04713 Circadian entrainment     14679 (Gnai3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     14679 (Gnai3)    05207 Chemical carcinogenesis - receptor activation     14679 (Gnai3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     14679 (Gnai3)    05163 Human cytomegalovirus infection     14679 (Gnai3)   09171 Infectious disease: bacterial    05133 Pertussis     14679 (Gnai3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     14679 (Gnai3)    05142 Chagas disease     14679 (Gnai3)   09164 Neurodegenerative disease    05012 Parkinson disease     14679 (Gnai3)   09165 Substance dependence    05030 Cocaine addiction     14679 (Gnai3)    05032 Morphine addiction     14679 (Gnai3)    05034 Alcoholism     14679 (Gnai3)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     14679 (Gnai3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     14679 (Gnai3)    04031 GTP-binding proteins [BR:mmu04031]     14679 (Gnai3) Exosome [BR:mmu04147]  Exosomal proteins   Proteins found in most exosomes    14679 (Gnai3) GTP-binding proteins [BR:mmu04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 1 (Gi/o) [OT]     14679 (Gnai3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  G-alpha Arf Gtr1_RagA Roc TniB FtsK_SpoIIIE AAA_29 Motif Other DBs NCBI-GeneID:  14679 NCBI-ProteinID:  NP_034436 MGI:  95773 Ensembl:  ENSMUSG00000000001 UniProt:  Q9DC51 Structure PDBPDBj LinkDB All DBs Position 3:complement(108014591..108053468) Genome browser AA seq 354 aa AA seqDB search MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGESARADDARQLFVLAGSAEEGVMT SELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA AYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac cgcaacttgcgggaggacggggagaaagcggccaaagaagtgaagctgctgctgctcggc gctggagaatctggtaaaagtaccatcgtgaaacagatgaaaatcattcatgaggacggc tattcagaggacgaatgtaaacagtataaagtagttgtctacagcaatactattcagtcc atcattgcaatcatacgagccatgggacggttgaagattgattttggggaatctgccaga gcagatgatgcccgacagttatttgttttagctgggagtgctgaagaaggagtcatgact tcagaactagcaggcgtgattaaacgtttatggcgagatggcggggtacaggcatgcttt agcaggtccagggaatatcagctcaatgattctgcttcatactacctaaatgatttggat agaatatcccagaccaactacattccaactcagcaagatgttcttcggacaagagtgaag actacaggcattgtggagacccacttcaccttcaaggaactctacttcaaaatgtttgat gtaggtggccaaagatccgaacgaaaaaagtggattcactgttttgagggagtgacagca attatcttttgtgtggctctcagtgattacgaccttgttctggctgaggatgaggaaatg aaccgaatgcatgaaagcatgaaattgtttgacagcatttgtaacaacaaatggtttaca gacacttcaatcattctctttcttaataagaaagacctttttgaggaaaaaataaagagg agtccattaacaatctgttatccagaatacacaggttccaatacatacgaagaggcagct gcttacattcagtgccagtttgaagatctgaaccgaagaaaagataccaaggaggtctac actcacttcacctgtgccacagacaccaaaaatgtgcagtttgtttttgatgctgttacg gatgtcatcattaaaaacaacttaaaggaatgtgggctttattga

DBGET integrated database retrieval system