| Entry |
|
|---|
| Symbol |
Gnaq, 1110005L02Rik, 6230401I02Rik, Dsk1, Dsk10, Galphaq, Gq, GqI
|
|---|
| Name |
(RefSeq) guanine nucleotide binding protein, alpha q polypeptide
|
|---|
| KO |
| K04634 | guanine nucleotide-binding protein G(q) subunit alpha |
|
|---|
| Organism |
mmu Mus musculus (house mouse)
|
|---|
| Pathway |
| mmu04261 | Adrenergic signaling in cardiomyocytes |
| mmu04270 | Vascular smooth muscle contraction |
| mmu04723 | Retrograde endocannabinoid signaling |
| mmu04750 | Inflammatory mediator regulation of TRP channels |
| mmu04925 | Aldosterone synthesis and secretion |
| mmu04927 | Cortisol synthesis and secretion |
| mmu04928 | Parathyroid hormone synthesis, secretion and action |
| mmu04935 | Growth hormone synthesis, secretion and action |
| mmu04961 | Endocrine and other factor-regulated calcium reabsorption |
| mmu05022 | Pathways of neurodegeneration - multiple diseases |
| mmu05163 | Human cytomegalovirus infection |
| mmu05170 | Human immunodeficiency virus 1 infection |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:mmu00001]
09130 Environmental Information Processing
09132 Signal transduction
04015 Rap1 signaling pathway
14682 (Gnaq)
04371 Apelin signaling pathway
14682 (Gnaq)
04020 Calcium signaling pathway
14682 (Gnaq)
04071 Sphingolipid signaling pathway
14682 (Gnaq)
04022 cGMP-PKG signaling pathway
14682 (Gnaq)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
14682 (Gnaq)
04081 Hormone signaling
14682 (Gnaq)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04540 Gap junction
14682 (Gnaq)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
14682 (Gnaq)
04062 Chemokine signaling pathway
14682 (Gnaq)
09152 Endocrine system
04911 Insulin secretion
14682 (Gnaq)
04922 Glucagon signaling pathway
14682 (Gnaq)
04929 GnRH secretion
14682 (Gnaq)
04912 GnRH signaling pathway
14682 (Gnaq)
04915 Estrogen signaling pathway
14682 (Gnaq)
04921 Oxytocin signaling pathway
14682 (Gnaq)
04935 Growth hormone synthesis, secretion and action
14682 (Gnaq)
04918 Thyroid hormone synthesis
14682 (Gnaq)
04928 Parathyroid hormone synthesis, secretion and action
14682 (Gnaq)
04916 Melanogenesis
14682 (Gnaq)
04924 Renin secretion
14682 (Gnaq)
04925 Aldosterone synthesis and secretion
14682 (Gnaq)
04927 Cortisol synthesis and secretion
14682 (Gnaq)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
14682 (Gnaq)
04270 Vascular smooth muscle contraction
14682 (Gnaq)
09154 Digestive system
04970 Salivary secretion
14682 (Gnaq)
04971 Gastric acid secretion
14682 (Gnaq)
04972 Pancreatic secretion
14682 (Gnaq)
09155 Excretory system
04961 Endocrine and other factor-regulated calcium reabsorption
14682 (Gnaq)
09156 Nervous system
04724 Glutamatergic synapse
14682 (Gnaq)
04725 Cholinergic synapse
14682 (Gnaq)
04728 Dopaminergic synapse
14682 (Gnaq)
04726 Serotonergic synapse
14682 (Gnaq)
04720 Long-term potentiation
14682 (Gnaq)
04730 Long-term depression
14682 (Gnaq)
04723 Retrograde endocannabinoid signaling
14682 (Gnaq)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
14682 (Gnaq)
09159 Environmental adaptation
04713 Circadian entrainment
14682 (Gnaq)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
14682 (Gnaq)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
14682 (Gnaq)
05163 Human cytomegalovirus infection
14682 (Gnaq)
09171 Infectious disease: bacterial
05135 Yersinia infection
14682 (Gnaq)
09174 Infectious disease: parasitic
05146 Amoebiasis
14682 (Gnaq)
05142 Chagas disease
14682 (Gnaq)
05143 African trypanosomiasis
14682 (Gnaq)
09164 Neurodegenerative disease
05010 Alzheimer disease
14682 (Gnaq)
05016 Huntington disease
14682 (Gnaq)
05017 Spinocerebellar ataxia
14682 (Gnaq)
05022 Pathways of neurodegeneration - multiple diseases
14682 (Gnaq)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
14682 (Gnaq)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:mmu04147]
14682 (Gnaq)
04031 GTP-binding proteins [BR:mmu04031]
14682 (Gnaq)
Exosome [BR:mmu04147]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
14682 (Gnaq)
GTP-binding proteins [BR:mmu04031]
Heterotrimeric G-proteins
Alpha Subunits
Alpha type 3 (Gq/11) [OT]
14682 (Gnaq)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| Structure |
|
|---|
| LinkDB |
|
|---|
| Position |
19:16110048..16365884
|
|---|
| AA seq |
359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV |
|---|
| NT seq |
1080 nt +upstreamnt +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggagg
atcaacgacgagatcgagcggcagctgcgcagggacaagcgcgacgcccgccgggagctc
aagctgctgctgctggggacaggggagagtggcaagagcaccttcatcaagcagatgagg
atcatccacgggtcgggctactctgacgaagacaagcgcggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagcgatggacacgctcaagatccca
tacaagtatgaacacaataaggctcatgcacaattggttcgagaggttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagcttgtggaatgatcctgga
atccaggagtgctacgacagacgacgggaatatcagttatctgactctaccaaatactat
ctgaatgacttggaccgtgtagccgacccttcctatctgcctacacaacaagacgtgctt
agagttcgagtccccactacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctccatcatgtttctagtagcgcttagcgaatatgatcaagttcttgtg
gagtcagacaatgagaaccgcatggaggagagcaaagcactctttagaacaattatcacc
tacccctggttccagaactcctctgtgattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccacctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagctcgagaattcatcctgaaaatgttcgtggacctgaaccccgacagt
gacaaaatcatctactcccacttcacgtgcgccacagataccgagaacatccgcttcgtc
tttgcagccgtcaaggacaccatcctgcagctgaacctgaaggagtacaatctggtctaa |
|---|
