Mus musculus (house mouse): 14707 Help Entry 14707             CDS       T01002                                  Symbol Gng5, G(y)5 Name (RefSeq) G protein subunit gamma 5   KO K04542   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 Organism mmu  Mus musculus (house mouse) Pathway mmu04014   Ras signaling pathway mmu04062   Chemokine signaling pathway mmu04081   Hormone signaling mmu04082   Neuroactive ligand signaling mmu04151   PI3K-Akt signaling pathway mmu04371   Apelin signaling pathway mmu04713   Circadian entrainment mmu04723   Retrograde endocannabinoid signaling mmu04724   Glutamatergic synapse mmu04725   Cholinergic synapse mmu04726   Serotonergic synapse mmu04727   GABAergic synapse mmu04728   Dopaminergic synapse mmu04926   Relaxin signaling pathway mmu05032   Morphine addiction mmu05034   Alcoholism mmu05163   Human cytomegalovirus infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     14707 (Gng5)    04371 Apelin signaling pathway     14707 (Gng5)    04151 PI3K-Akt signaling pathway     14707 (Gng5)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     14707 (Gng5)    04081 Hormone signaling     14707 (Gng5)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     14707 (Gng5)   09152 Endocrine system    04926 Relaxin signaling pathway     14707 (Gng5)   09156 Nervous system    04724 Glutamatergic synapse     14707 (Gng5)    04727 GABAergic synapse     14707 (Gng5)    04725 Cholinergic synapse     14707 (Gng5)    04728 Dopaminergic synapse     14707 (Gng5)    04726 Serotonergic synapse     14707 (Gng5)    04723 Retrograde endocannabinoid signaling     14707 (Gng5)   09159 Environmental adaptation    04713 Circadian entrainment     14707 (Gng5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     14707 (Gng5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     14707 (Gng5)    05163 Human cytomegalovirus infection     14707 (Gng5)    05167 Kaposi sarcoma-associated herpesvirus infection     14707 (Gng5)   09165 Substance dependence    05032 Morphine addiction     14707 (Gng5)    05034 Alcoholism     14707 (Gng5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     14707 (Gng5)    04031 GTP-binding proteins [BR:mmu04031]     14707 (Gng5) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    14707 (Gng5) GTP-binding proteins [BR:mmu04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     14707 (Gng5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  G-gamma Suv3_N FtsX_ECD Motif Other DBs NCBI-GeneID:  14707 NCBI-ProteinID:  NP_034448 MGI:  109164 Ensembl:  ENSMUSG00000068523 UniProt:  Q80SZ7 Q3UKC8 LinkDB All DBs Position 3:146205591..146211298 Genome browser AA seq 68 aa AA seqDB search MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR PQKVCSFL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtcgggttcttctagcgtcgccgccatgaagaaggtggtccagcagctccggctggag gccgggctcaaccgcgtgaaggtttcccaggcagctgcagacttgaaacagttctgtctg cagaatgctcaacatgaccctctgctgactggagtgtcttcaagtacgaatcccttcaga ccccagaaagtctgctcctttttgtag

DBGET integrated database retrieval system