KEGG   Mus musculus (house mouse): 15529
Entry
15529             CDS       T01002                                 
Symbol
Sdc2, 4833414L08Rik, AA960457, Hspg1, Synd2, syndecan-2
Name
(RefSeq) syndecan 2
  KO
K16336  syndecan 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu05144  Malaria
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15529 (Sdc2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    15529 (Sdc2)
  09174 Infectious disease: parasitic
   05144 Malaria
    15529 (Sdc2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    15529 (Sdc2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    15529 (Sdc2)
   00535 Proteoglycans [BR:mmu00535]
    15529 (Sdc2)
CD molecules [BR:mmu04090]
 Proteins
  15529 (Sdc2)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   15529 (Sdc2)
SSDB
Motif
Pfam: Syndecan Glycophorin_A Peptidase_M50 DUF2721 Cadherin_C_2 MtrF
Other DBs
NCBI-GeneID: 15529
NCBI-ProteinID: NP_032330
MGI: 1349165
Ensembl: ENSMUSG00000022261
Vega: OTTMUSG00000027993
UniProt: P43407
LinkDB
Position
15:32920869..33034867
AA seq 202 aa
MQRAWILLTLGLMACVSAETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGAD
EDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEE
KLGPAIKSTDVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSY
DLGERKPSSAAYQKAPTKEFYA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgcagcgcgcgtggatcctgctcaccttgggcttgatggcctgtgtgtccgcagagacg
agaacagagctgacatccgataaggatatgtaccttgacaatagctccattgaggaagct
tcaggagtatatcctattgatgatgatgactattcttctgcctcaggctcaggagctgat
gaagacatagagagtccagttctgacaacatcccaactgattccaagaatcccactcact
agtgctgcttcccccaaagtggaaaccatgacgttgaagacacaaagcattacacctgct
cagactgagtcacctgaagaaactgacaaggaggaagttgacatttctgaggcagaagag
aagctgggccctgctataaaaagcacagatgtgtacacggagaaacattcagacaatctg
tttaaacggacagaagttctagcagccgtcattgctggtggtgtgatcggctttctcttt
gccattttcctcatcctgctattggtgtaccgcatgcggaagaaagatgaaggaagctac
gaccttggagaacgcaaaccatccagcgcagcttaccagaaggcacccactaaggagttt
tatgcataa

DBGET integrated database retrieval system