Mus musculus (house mouse): 15874 Help Entry 15874             CDS       T01002                                  Symbol Iapp, DAP Name (RefSeq) islet amyloid polypeptide   KO K08039   islet amyloid polypeptide Organism mmu  Mus musculus (house mouse) Pathway mmu04080   Neuroactive ligand-receptor interaction mmu04950   Maturity onset diabetes of the young Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     15874 (Iapp)  09160 Human Diseases   09167 Endocrine and metabolic disease    04950 Maturity onset diabetes of the young     15874 (Iapp)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     15874 (Iapp) Cytokines and neuropeptides [BR:mmu04052]  Neuropeptides   Neuropeptides (GPCR binding)    15874 (Iapp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Calc_CGRP_IAPP Motif Other DBs NCBI-GeneID:  15874 NCBI-ProteinID:  NP_034621 MGI:  96382 Ensembl:  ENSMUSG00000041681 UniProt:  P12968 LinkDB All DBs Position 6:142244151..142249546 Genome browser AA seq 93 aa AA seqDB search MMCISKLPAVLLILSVALNHLRATPVRSGSNPQMDKRKCNTATCATQRLANFLVRSSNNL GPVLPPTNVGSNTYGKRNAAGDPNRESLDFLLV NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcatctccaaactgccagctgtcctcctcatcctctctgtggcactgaaccac ttgagagctacacctgtcagaagtggtagcaaccctcagatggacaaacggaagtgcaac acggccacgtgtgccacacaacgcctggcaaactttttggttcgttccagcaacaacctt ggtccagtcctcccaccaaccaacgtgggatcgaatacatatggcaagaggaatgcggca ggggatccaaatagggaatccttggatttcttactcgtttaa

DBGET integrated database retrieval system