Mus musculus (house mouse): 15974 Help Entry 15974             CDS       T01002                                  Symbol Ifnab, If1ai8 Name (RefSeq) interferon alpha B   KO K05414   interferon alpha Organism mmu  Mus musculus (house mouse) Pathway mmu04060   Cytokine-cytokine receptor interaction mmu04151   PI3K-Akt signaling pathway mmu04217   Necroptosis mmu04620   Toll-like receptor signaling pathway mmu04621   NOD-like receptor signaling pathway mmu04622   RIG-I-like receptor signaling pathway mmu04623   Cytosolic DNA-sensing pathway mmu04630   JAK-STAT signaling pathway mmu04650   Natural killer cell mediated cytotoxicity mmu04936   Alcoholic liver disease mmu05152   Tuberculosis mmu05160   Hepatitis C mmu05161   Hepatitis B mmu05162   Measles mmu05163   Human cytomegalovirus infection mmu05164   Influenza A mmu05165   Human papillomavirus infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05168   Herpes simplex virus 1 infection mmu05169   Epstein-Barr virus infection mmu05170   Human immunodeficiency virus 1 infection mmu05171   Coronavirus disease - COVID-19 mmu05200   Pathways in cancer mmu05320   Autoimmune thyroid disease mmu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     15974 (Ifnab)    04151 PI3K-Akt signaling pathway     15974 (Ifnab)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     15974 (Ifnab)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     15974 (Ifnab)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     15974 (Ifnab)    04621 NOD-like receptor signaling pathway     15974 (Ifnab)    04622 RIG-I-like receptor signaling pathway     15974 (Ifnab)    04623 Cytosolic DNA-sensing pathway     15974 (Ifnab)    04650 Natural killer cell mediated cytotoxicity     15974 (Ifnab)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     15974 (Ifnab)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     15974 (Ifnab)    05161 Hepatitis B     15974 (Ifnab)    05160 Hepatitis C     15974 (Ifnab)    05171 Coronavirus disease - COVID-19     15974 (Ifnab)    05164 Influenza A     15974 (Ifnab)    05162 Measles     15974 (Ifnab)    05168 Herpes simplex virus 1 infection     15974 (Ifnab)    05163 Human cytomegalovirus infection     15974 (Ifnab)    05167 Kaposi sarcoma-associated herpesvirus infection     15974 (Ifnab)    05169 Epstein-Barr virus infection     15974 (Ifnab)    05165 Human papillomavirus infection     15974 (Ifnab)   09171 Infectious disease: bacterial    05152 Tuberculosis     15974 (Ifnab)   09163 Immune disease    05320 Autoimmune thyroid disease     15974 (Ifnab)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     15974 (Ifnab)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     15974 (Ifnab)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     15974 (Ifnab) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Interferons    15974 (Ifnab) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Aip3p_Bud6_N Motif Other DBs NCBI-GeneID:  15974 NCBI-ProteinID:  NP_032362 MGI:  1097683 Ensembl:  ENSMUSG00000100079 UniProt:  L7MTU6 Q61719 LinkDB All DBs Position 4:complement(88608836..88609505) Genome browser AA seq 190 aa AA seqDB search MARLSTFLMVLAVMSYWSTCPLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG FPQEKVDAQQIQEAQAIPVLTELTQQMLTLFTSKASSAAWNATLLDSFCNDLHQQLNDLK TCLMQEVGVQESPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVWRALSSSAK LLASLSEEKE NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atggctaggctcagcactttcctaatggtcctggcagtgatgagctactggtcaacctgc cctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgacactc ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggacttcgga ttcccccaggagaaggtggatgcccagcagatccaggaggctcaagccatccctgtcctg actgagctgacccagcagatgctgaccctcttcacatcaaaggcttcatctgctgcttgg aatgcaaccctactagactcattctgcaatgacctccaccagcaactcaatgacctgaaa acctgtctgatgcaggaggtgggggtgcaggaatctcccctgacccaggaagactccctg ctggctgtgaggaaatacttccacagcatcactgtgtacctgagagagaagaaacacagc ccctgtgcctgggaagtggtcagagcagaagtctggagagccctgtcttcctcagccaag ttgctggcaagtctgagtgaggagaaggagtga

DBGET integrated database retrieval system