Mus musculus (house mouse): 16160 Help Entry 16160             CDS       T01002                                  Symbol Il12b, Il-12b, Il-12p40, Il12p40, p40 Name (RefSeq) interleukin 12b   KO K05425   interleukin 12B Organism mmu  Mus musculus (house mouse) Pathway mmu04060   Cytokine-cytokine receptor interaction mmu04620   Toll-like receptor signaling pathway mmu04622   RIG-I-like receptor signaling pathway mmu04625   C-type lectin receptor signaling pathway mmu04630   JAK-STAT signaling pathway mmu04658   Th1 and Th2 cell differentiation mmu04936   Alcoholic liver disease mmu04940   Type I diabetes mellitus mmu05133   Pertussis mmu05134   Legionellosis mmu05140   Leishmaniasis mmu05142   Chagas disease mmu05143   African trypanosomiasis mmu05145   Toxoplasmosis mmu05146   Amoebiasis mmu05152   Tuberculosis mmu05162   Measles mmu05164   Influenza A mmu05168   Herpes simplex virus 1 infection mmu05171   Coronavirus disease - COVID-19 mmu05200   Pathways in cancer mmu05205   Proteoglycans in cancer mmu05321   Inflammatory bowel disease mmu05330   Allograft rejection mmu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     16160 (Il12b)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     16160 (Il12b)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     16160 (Il12b)    04622 RIG-I-like receptor signaling pathway     16160 (Il12b)    04625 C-type lectin receptor signaling pathway     16160 (Il12b)    04658 Th1 and Th2 cell differentiation     16160 (Il12b)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     16160 (Il12b)    05205 Proteoglycans in cancer     16160 (Il12b)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     16160 (Il12b)    05164 Influenza A     16160 (Il12b)    05162 Measles     16160 (Il12b)    05168 Herpes simplex virus 1 infection     16160 (Il12b)   09171 Infectious disease: bacterial    05133 Pertussis     16160 (Il12b)    05134 Legionellosis     16160 (Il12b)    05152 Tuberculosis     16160 (Il12b)   09174 Infectious disease: parasitic    05146 Amoebiasis     16160 (Il12b)    05145 Toxoplasmosis     16160 (Il12b)    05140 Leishmaniasis     16160 (Il12b)    05142 Chagas disease     16160 (Il12b)    05143 African trypanosomiasis     16160 (Il12b)   09163 Immune disease    05321 Inflammatory bowel disease     16160 (Il12b)    05330 Allograft rejection     16160 (Il12b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     16160 (Il12b)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     16160 (Il12b)    04936 Alcoholic liver disease     16160 (Il12b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     16160 (Il12b)    00536 Glycosaminoglycan binding proteins [BR:mmu00536]     16160 (Il12b) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Interleukins    16160 (Il12b) Glycosaminoglycan binding proteins [BR:mmu00536]  Heparan sulfate / Heparin   Cytokines    16160 (Il12b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12p40_C Ig_3 Ig_5 Ig_2 fn3 Ig_4 I-set ig Motif Other DBs NCBI-GeneID:  16160 NCBI-ProteinID:  NP_001290173 MGI:  96540 Ensembl:  ENSMUSG00000004296 UniProt:  P43432 Q3ZAX5 Structure PDBPDBj LinkDB All DBs Position 11:44290890..44305504 Genome browser AA seq 335 aa AA seqDB search MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITW TSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF KNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLD QRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQ MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt atgtgtcctcagaagctaaccatctcctggtttgccatcgttttgctggtgtctccactc atggccatgtgggagctggagaaagacgtttatgttgtagaggtggactggactcccgat gcccctggagaaacagtgaacctcacctgtgacacgcctgaagaagatgacatcacctgg acctcagaccagagacatggagtcataggctctggaaagaccctgaccatcactgtcaaa gagtttctagatgctggccagtacacctgccacaaaggaggcgagactctgagccactca catctgctgctccacaagaaggaaaatggaatttggtccactgaaattttaaaaaatttc aaaaacaagactttcctgaagtgtgaagcaccaaattactccggacggttcacgtgctca tggctggtgcaaagaaacatggacttgaagttcaacatcaagagcagtagcagttcccct gactctcgggcagtgacatgtggaatggcgtctctgtctgcagagaaggtcacactggac caaagggactatgagaagtattcagtgtcctgccaggaggatgtcacctgcccaactgcc gaggagaccctgcccattgaactggcgttggaagcacggcagcagaataaatatgagaac tacagcaccagcttcttcatcagggacatcatcaaaccagacccgcccaagaacttgcag atgaagcctttgaagaactcacaggtggaggtcagctgggagtaccctgactcctggagc actccccattcctacttctccctcaagttctttgttcgaatccagcgcaagaaagaaaag atgaaggagacagaggaggggtgtaaccagaaaggtgcgttcctcgtagagaagacatct accgaagtccaatgcaaaggcgggaatgtctgcgtgcaagctcaggatcgctattacaat tcctcatgcagcaagtgggcatgtgttccctgcagggtccgatcctag

DBGET integrated database retrieval system