KEGG   Mus musculus (house mouse): 16401
Entry
16401             CDS       T01002                                 
Symbol
Itga4, CD49D, Itga4B
Name
(RefSeq) integrin alpha 4
  KO
K06483  integrin alpha 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04640  Hematopoietic cell lineage
mmu04670  Leukocyte transendothelial migration
mmu04672  Intestinal immune network for IgA production
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16401 (Itga4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16401 (Itga4)
   04514 Cell adhesion molecules
    16401 (Itga4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16401 (Itga4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16401 (Itga4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16401 (Itga4)
   04670 Leukocyte transendothelial migration
    16401 (Itga4)
   04672 Intestinal immune network for IgA production
    16401 (Itga4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16401 (Itga4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16401 (Itga4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    16401 (Itga4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16401 (Itga4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16401 (Itga4)
   05414 Dilated cardiomyopathy
    16401 (Itga4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16401 (Itga4)
   04515 Cell adhesion molecules [BR:mmu04515]
    16401 (Itga4)
   04090 CD molecules [BR:mmu04090]
    16401 (Itga4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16401 (Itga4)
  Exosomal proteins of other cancer cells
   16401 (Itga4)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16401 (Itga4)
CD molecules [BR:mmu04090]
 Proteins
  16401 (Itga4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha MGTA_C
Other DBs
NCBI-GeneID: 16401
NCBI-ProteinID: NP_034706
MGI: 96603
Ensembl: ENSMUSG00000027009
UniProt: Q00651 Q792F9 Q8BQ25
LinkDB
Position
2:79084767..79163458
AA seq 1032 aa
MAAEARCRPRSRGIALREAVMLLLYFGVPTGHSYNLDPENALLYQGPSGTLFGYSVVLHS
HGSKRWLIVGAPTASWLSNASVVNPGAIYRCGIRKNPNQTCEQLQLGSPSGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYMKSDNKLPTGICYVMPSDLRTELSKRM
APCYKDYTRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGTVFVYNITTNQYKAFVD
RQNQVKFGSYLGYSVGAGHFRSPHTTEVVGGAPQHEQIGKAYIFSIDENELNIVYEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGMGAVMVEMERVLVG
SDKYAARFGESIANLGDIDNDGFEDIAIGAPQEDDLRGAVYIYNGRVDGISSTYSQRIEG
QQISKSLRMFGQSISGQIDADNNGYVDVAVGAFQSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCTENGLPSVCMHLTLCFSYKGKEVPGYIVLFYNVSLDVHRKAESPSRFYFFSNGT
SDVITGSIRVSSSGEKCRTHQAFMRKDVRDILTPIHVEATYHLGHHVITKRNTEEFPPLQ
PILQQKKEKDVIRKMINFARFCAYENCSADLQVSAKVGFLKPYENKTYLAVGSMKTIMLN
VSLFNAGDDAYETTLNVQLPTGLYFIKILDLEEKQINCEVTESSGIVKLACSLGYIYVDR
LSRIDISFLLDVSSLSRAHEDLSISVHASCENEGELDQVRDNRVTLTIPLRYEVMLTVHG
LVNPTSFVYGSSEENEPETCMAEKLNLTFHVINTGISMAPNVSVKIMVPNSFLPQDDKLF
NVLDVQTTTGQCHFKHYGRECTFAQQKGIAGTLTDIVKFLSKTDKRLLYCMKADQHCLDF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSSLKFEIKATAFPEPHPKVIELNKDENVA
HVFLEGLHHQRPKRHFTIIIITISLLLGLIVLLLISCVMWKAGFFKRQYKSILQEENRRD
SWSYVNSKSNDD
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggctgcggaagcgaggtgcagaccgaggtcccgagggatcgccctccgggaagcggtg
atgctgttgttgtacttcggggtgccaaccgggcactcctacaacctggacccggagaat
gcactgctgtaccagggcccctccggcacgctgtttggctactcggtggtgctgcacagc
cacgggtcgaagcgctggctcatcgtgggggctcccactgccagctggctctctaatgcc
tcagtggtcaatcctggggcgatttacagatgcgggatcagaaagaatccaaaccagacc
tgcgaacagctccagctgggtagccccagtggagagccttgtgggaagacatgcctggag
gagagggataaccagtggctgggggtcaccctttccagacagcctggagaaaatggctct
atcgtgacttgtgggcacaggtggaaaaatattttttacatgaagagcgataacaaactc
cccactggcatttgctacgtcatgccttctgatttgcggacagaactgagtaaaaggatg
gccccgtgttacaaagattatacgagaaaatttggagaaaattttgcatcatgtcaagct
ggaatatctagtttttacacacaggatttaattgtgatgggggccccgggatcatcgtac
tggactggcaccgtctttgtctacaatataactacaaaccaatacaaagcatttgtagac
agacagaaccaagtaaaatttggaagctacttaggctactcagttggagctggacatttt
cgaagtccacatactaccgaagtcgtgggaggagcccctcaacacgaacagataggaaaa
gcatatatatttagcattgatgaaaacgaactgaacatcgtatatgaaatgaaaggtaaa
aagcttggctcatactttggagcttctgtctgcgctgtggacctcaatgcagatggcttc
tcagatctccttgttggagctcccatgcagagcaccatcagggaggaaggaagagtattc
gtgtacatcaactctggcatgggagctgtgatggttgaaatggaaagggtccttgtcgga
agtgacaaatatgctgcaagatttggggagtctatagcgaatcttggcgacattgacaat
gacggctttgaagatattgctattggtgcaccacaagaagacgacttgagaggtgctgtc
tacatttacaatggccgagtcgatggaatctcctccacctactcacagagaattgaagga
cagcaaatcagcaaatcattaaggatgtttggacaatctatctcaggacaaattgatgca
gacaacaatggatatgttgatgtagccgttggtgcatttcaatctgattctgcagtgttg
ctaaggacaaggcctgtagtgattgttgaagcatctttaagccatcctgagtctgtaaat
aggacaaagtttgactgtactgaaaatggacttccatctgtgtgcatgcatcttacactg
tgtttctcatataaaggcaaagaggtcccaggctacatcgttttgttttacaatgtgagc
ttggatgtgcacaggaaggcagagtctccgtcaagattttatttcttctctaatgggact
tctgacgtgattacaggaagcatacgagtttcaagcagtggagagaaatgtaggacacac
caggcattcatgcggaaagacgtgcgagacatccttacccccattcatgtagaggccaca
taccaccttgggcatcatgtgatcaccaaacgaaacactgaggaatttccaccactccag
ccgatccttcagcagaagaaagaaaaagacgttattagaaaaatgataaactttgcaagg
ttttgtgcctatgaaaattgctctgctgatctccaagtttctgcaaaagttggatttttg
aagccatatgaaaataaaacctatcttgctgttgggagcatgaagaccataatgctaaac
gtgtccttgttcaacgctggcgatgatgcttacgaaaccactctgaatgtccaactcccc
acaggcctttatttcattaagatcttagacctggaagagaaacaaataaactgcgaagtg
actgagagctcaggcatagtgaagcttgcctgcagcctaggttacatatatgtggatcgc
ctctcaaggatagacattagctttctcctggatgtgagctcactcagcagggcacatgag
gacctcagcatcagtgtgcatgcctcctgtgaaaacgagggcgaattggaccaagtgagg
gacaacagagtgaccttaacgatacctctaaggtatgaggttatgctgactgttcatggg
cttgtgaacccaacttcatttgtgtatggatctagcgaagaaaacgagccagaaacatgc
atggccgagaagctgaacctcactttccatgttataaacactgggattagcatggctcca
aatgttagtgtgaaaataatggtaccaaattcttttctccctcaagatgataagttgttc
aacgttttggatgtccagacaactacagggcaatgccattttaaacactatggaagagag
tgtacatttgcacagcaaaaaggcatagcggggacgttgaccgatatagtcaaattccta
tcaaagactgataagagactcctgtattgcatgaaagctgatcaacactgtttagatttc
ttatgcaatttcggaaaaatggaaagtgggaaggaagccagcgttcatattcagctggag
ggcaggccatccatcttggaaatggatgagacctcatcactcaagtttgaaataaaagca
acagcttttccagagccacacccaaaagttattgaactaaataaagatgagaacgtggcc
catgttttcttggaagggctccatcatcaaagacccaaacgacatttcaccatcattatt
attaccatcagcttgctacttggacttattgtacttttattaatttcatgtgttatgtgg
aaggctggattctttaaaagacagtacaaatctatcctacaagaagaaaacaggagagac
agctggagttatgtcaacagcaaaagcaatgatgactga

KEGG   Mus musculus (house mouse): 16421
Entry
16421             CDS       T01002                                 
Symbol
Itgb7, Ly69
Name
(RefSeq) integrin beta 7
  KO
K06590  integrin beta 7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04672  Intestinal immune network for IgA production
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05202  Transcriptional misregulation in cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16421 (Itgb7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16421 (Itgb7)
   04514 Cell adhesion molecules
    16421 (Itgb7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16421 (Itgb7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16421 (Itgb7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    16421 (Itgb7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    16421 (Itgb7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16421 (Itgb7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16421 (Itgb7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16421 (Itgb7)
   05414 Dilated cardiomyopathy
    16421 (Itgb7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16421 (Itgb7)
   04515 Cell adhesion molecules [BR:mmu04515]
    16421 (Itgb7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16421 (Itgb7)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16421 (Itgb7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 16421
NCBI-ProteinID: NP_038594
MGI: 96616
Ensembl: ENSMUSG00000001281
UniProt: P26011
LinkDB
Position
15:complement(102124429..102141840)
AA seq 806 aa
MVDSSTVLIFLLVLGGGQSELDTKITSSGEAAEWEDPDLSLQGSCQPVPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPAQELEEPRGRQEVLQDKPLSQGDRGEGA
TQLAPQRIRVTLRPGEPQKFRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLHHPCPSRLERCQPPFSFHHVLSLTGDAQ
AFEREVGRQNVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGRCHLDSNGVYTNSAEFDYPSVGQVAQALTAANIQPIFAVTGATLPVYQELR
QLIPKSAVGELSEDSSNVVQLIMDAYDSLSSTVTLEHSPLPPGVSISFESHCKGPEKTEG
EAGDRGQCNDVRVNQTVDFWVTLQATHCLPEAHVLRLWALGFSEELTVELHTVCDCNCGD
AQPHAPYCSDGQGDLQCGICSCAPGRLGQLCECSEADLSSPDLESGCRAPNGTGPLCSGK
GRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGHCQCGVCHCHANHTGRACECSK
SVDSCVSPEGGLCSGHGYCKCNRCQCLDGYYGALCDQCLGCKSPCEQYRDCAECGAFGTG
PLAANCSVVCADVNVTLTLAPNLDDGWCKERTIDNQLFFFLVEHAASGIVLRVRPQEKGV
DHTRAIILGCTGGIVAVGLGLVLAYRLSVEIYDRREYRRFEKEQQQLNWKQDNNPLYKSA
ITTTVNPRFQGTNGRSPSLSLTREAD
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggtggattcatcaactgttctcatttttctgctggttctgggcggaggtcagagtgag
ttagataccaagattacatcctctggggaggccgcagaatgggaggatcctgacctgtct
ctgcagggatcctgccagccagttccttcctgccagaagtgtattctctcacatcccagc
tgtgcatggtgcaaacaactgaacttcactgcctcgggagaggcagaggcgaggcgctgc
gcgcggcgagaggagctactggctcgcgggtgccccgcgcaggagctagaggagccgaga
ggccgccaggaggtgctgcaggacaagccgctcagccagggagatcgcggcgagggggcc
acccagctggccccgcagcggatccgcgtcacgctgcgaccaggggagccccagaaattc
cgggtccgcttcctccgagctgcggggtaccccgtggacctatattaccttatggacctg
agctactcaatgaaggacgacttggaacgtgtgcgccagctagggcatgccctgctggtc
aggctgcaggaggtcacacattctgtgcgcataggttttggctccttcgtggacaaaacg
gtgctgccctttgtaagcaccgtgccctccaagcttcaccacccatgccccagccgactg
gagcgttgtcagccacccttcagctttcaccacgtgctgtccctcaccggggacgctcaa
gccttcgagagagaggtgggacgccagaatgtctctggcaacctggactcacccgaaggc
ggctttgatgccattttgcaggctgccctctgccaggaacagattggctggagaaatgtc
tcccgtcttctagtgttcacttcagacgatacattccacacagctggggatgggaaactg
ggtggcattttcatgcccagcgacgggcggtgccatctggacagcaatggtgtctacacg
aacagcgcagagtttgactatccctctgtgggtcaagtagcccaggccctcactgcagcg
aatatccaacctatctttgctgtcaccggtgcaacactgcctgtgtatcaggagctgaga
cagttgattcccaagtctgctgtcggggagctgagtgaggactccagcaatgtggtgcag
ctcatcatggatgcttatgatagcctgtcatccactgtgactcttgagcactctccactc
ccaccaggagtcagcatctcctttgaatctcactgtaagggtcctgagaagacggagggt
gaggctggggaccggggacagtgcaatgatgtccgagtcaaccagacggtggatttctgg
gtcactcttcaagctactcactgcctcccagaagcccacgtcctacgactctgggctctt
ggcttctcagaggagttaactgtggagctgcacacagtgtgcgactgtaactgtggtgat
gcccagcctcacgctccctactgcagtgatggacagggggaccttcagtgcgggatatgc
agctgtgcccctggccgtcttggtcagctgtgtgaatgctctgaggctgacctgtcctcc
ccagatttggaatctggttgccgggccccaaacgggacagggcccctatgcagcgggaag
ggtcgatgccaatgtggacgctgcagctgcagtgggcagagctctgggcgtctgtgcgag
tgtgatgatgccagctgtgagcgacatgagggcatcctctgtggaggctttggccactgc
cagtgtggagtatgtcactgtcacgccaaccacaccggcagagcttgcgagtgcagcaag
agtgtagacagctgtgtcagtcctgaaggagggctctgcagtgggcacggatactgcaaa
tgcaaccgttgccagtgcctggatggctactacggggctctgtgtgaccagtgcctaggc
tgcaagtcaccatgtgagcagtacagggattgtgcagagtgcggggcatttggtaccggt
cccctggcagccaactgtagtgtggtctgtgctgacgtgaatgtgaccttgaccttggcc
cctaacttggatgatggctggtgcaaagaaaggacaatagacaaccagctgttcttcttc
ctggtggagcatgcagccagcgggatcgtactgagagtgagaccccaagagaagggagtg
gatcacacccgtgccatcatactgggctgcacagggggcatcgtggcagtgggactaggg
ctggttctggcttaccggctctctgtggaaatctacgaccgacgggagtacaggcgcttt
gagaaggagcagcagcaactcaactggaagcaggacaacaatcctctctacaaaagtgcg
atcacaaccactgtcaacccccgcttccaagggacaaacggtcggtcgccatccctctct
ctgaccagggaagcagactga

DBGET integrated database retrieval system