KEGG   Mus musculus (house mouse): 16411
Entry
16411             CDS       T01002                                 
Symbol
Itgax, AI449405, Cd11c, Cr4, N418
Name
(RefSeq) integrin alpha X
  KO
K06462  integrin alpha X
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04810  Regulation of actin cytoskeleton
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16411 (Itgax)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    16411 (Itgax)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16411 (Itgax)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    16411 (Itgax)
   04090 CD molecules [BR:mmu04090]
    16411 (Itgax)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16411 (Itgax)
CD molecules [BR:mmu04090]
 Proteins
  16411 (Itgax)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 16411
NCBI-ProteinID: NP_067309
MGI: 96609
Ensembl: ENSMUSG00000030789
UniProt: Q9QXH4
LinkDB
Position
7:127728697..127749829
AA seq 1169 aa
MSCTWIAFLLLLGFVSCLGFNLDAEKLTHFHMDGAEFGHSVLQYDSSWVVVGAPKEIKAT
NQIGGLYKCGYHTGNCEPISLQVPPEAVNISLGLSLAAATNPSWLLACGPTVHHTCRENI
YLTGLCFLLSSSFKQSQNFPTAQQECPKQDQDIVFLIDGSGSISSTDFEKMLDFVKAVMS
QLQRPSTRFSLMQFSDYFRVHFTFNNFISTSSPLSLLGSVRQLRGYTYTASAIKHVITEL
FTTQSGARQDATKVLIVITDGRKQGDNLSYDSVIPMAEAASIIRYAIGVGKAFYNEHSKQ
ELKAIASMPSHEYVFSVENFDALKDIENQLKEKIFAIEGTETPSSSTFELEMSQEGFSAV
FTPDGPVLGAVGSFSWSGGAFLYPSNMRPTFINMSQENEDMRDAYLGYSTALAFWKGVHS
LILGAPRHQHTGKVVIFTQESRHWRPKSEVRGTQIGSYFGASLCSVDMDRDGSTDLVLIG
VPHYYEHTRGGQVSVCPMPGVGSRWHCGTTLHGEQGHPWGRFGAALTVLGDVNGDSLADV
AIGAPGEEENRGAVYIFHGASRQDIAPSPSQRISASQIPSRIQYFGQSLSGGQDLTRDGL
VDLAVGSKGRVLLLRTRPILRVSPTVHFTPAEISRSVFECQEQVAPEQTLSDATVCLHIH
ESPKTQLGDLRSTVTFDLALDHGRLSTRAIFKETKTRALTRVKTLGLNKHCESVKLLLPA
CVEDSVTPITLRLNFSLVGVPISSLQNLQPMLAVDDQTYFTASLPFEKNCGADHICQDDL
SVVFGFPDLKTLVVGSDLELNVDVTVSNDGEDSYGTTVTLFYPVGLSFRRVAEGQVFLRK
KEDQQWQRRGQHSLHLMCDSTPDRSQGLWSTSCSSRHVIFRGGSQMTFLVTFDVSPKAEL
GDRLLLRARVGSENNVPGTPKTTFQLELPVKYAVYTMISSHDQFTKYLNFSTSEKEKTSV
VEHRFQVNNLGQRDVPVSINFWVPIELKGEAVWTVMVSHPQNPLTQCYRNRLKPTQFDLL
THMQKSPVLDCSIADCLHLRCDIPSLGILDELYFILKGNLSFGWISQTLQKKVLLLSEAE
ITFNTSVYSQLPGQEAFLRAQTKTVLEMYKVHNPVPLIVGSSVGGLLLLAIITAILYKAG
FFKRQYKEMLEEANGQFVSDGTPTPQVAQ
NT seq 3510 nt   +upstreamnt  +downstreamnt
atgagctgtacctggatagcctttcttctgctgttggggtttgtttcttgtcttggcttc
aacttggatgcagagaagctgacacattttcacatggacggtgctgagttcggacacagt
gtgctccagtatgatagttcctgggtggtggttggagcaccaaaggaaataaaagccact
aaccaaataggtggcctctacaaatgtggctatcacacaggcaactgtgagcccatctcc
ctccaggtgcccccagaggctgtgaacatatccctgggcctgtcccttgctgctgccacc
aacccttcctggctgttggcttgtggtcctactgtgcaccacacatgcagagagaatata
tacttgacagggctctgctttctactgagttcatcattcaagcagagccagaacttccca
actgcacagcaggagtgtccaaagcaagaccaagacatcgtgttcctgattgatggctcg
ggtagcatcagttccacagattttgaaaaaatgctggactttgttaaagctgtgatgagc
cagcttcagagacctagcacacggttctccctgatgcagttctctgattacttccgagta
cattttactttcaacaacttcatctccacgtcaagccctttaagtctgttgggttctgta
aggcagctaagagggtacacatacacagcctcggctatcaagcatgtcataacagaactg
ttcaccacccaaagtggagctcggcaagatgccaccaaggtcctcattgtcatcactgat
gggagaaaacaaggggacaacttgagttatgatagtgtcatccccatggcagaggctgca
agcatcattcgttatgcaattggggtaggaaaggccttttacaatgaacattccaagcaa
gaattaaaggccattgcatcgatgccttcccatgaatacgtattcagcgtggagaacttt
gatgctttgaaggatattgagaatcagctgaaggagaagatctttgccattgagggcaca
gagacaccaagcagcagtacttttgaattggagatgtcccaggagggcttcagtgctgtg
tttacacctgatggaccagttctgggggctgtgggaagcttcagctggtctggaggtgcc
ttcttgtacccctcaaatatgagacccaccttcatcaacatgtctcaggagaacgaggac
atgagggacgcttacctgggttactccaccgcactggccttttggaagggggtccacagc
ctgatcctgggggcccctcgccaccagcacacggggaaggttgtcatctttacccaggaa
tccaggcactggaggcccaagtctgaagtcagagggacacagatcggctcctactttggg
gcatctctttgttctgtggacatggatagagatggcagcactgacctggtcctgattgga
gtcccccattactatgagcacacccgaggggggcaggtgtcagtgtgccccatgcccggt
gtggggagcaggtggcattgtgggaccaccctccatggggagcagggccatccttggggc
cgctttggggcggctctgacagtgctaggggacgtgaatggggacagtctggcagatgtg
gctattggtgcacccggagaggaggagaacagaggtgctgtctacatatttcatggagcc
tcaagacaggacatcgctccctcacccagccagaggatttcagcatcccagatcccctcc
aggattcaatattttgggcagtcactgagtgggggccaggacctcacccgggatggactg
gtggatctggccgtgggctccaagggacgcgtgctgctgctcaggaccagaccaattctt
agagtgtcaccaactgttcacttcacacctgcagagatttccaggtctgtgtttgagtgt
caggagcaggtggcccctgagcagacactgagtgatgccactgtctgccttcatattcat
gaaagccccaagacccaactaggtgacctccgaagtactgtcacctttgacctggctcta
gaccatggccgtctgagtacccgggccatcttcaaggagacaaagacccgggctctgact
cgagttaaaactcttggtctgaacaagcactgtgaaagtgtgaagttgcttctcccggcc
tgtgtggaggactcagtgaccccgatcactcttcgcctcaacttttctcttgttggtgtg
cccatcagttccttacaaaatctccaacccatgctggctgtagatgaccaaacgtacttc
acggcctctcttccctttgagaagaactgtggagctgaccacatctgccaggatgacctt
agtgtcgtatttggcttcccagacttgaagaccctggtggtgggaagtgacctggagctg
aatgtagatgtgacggtgtctaatgatggagaagattcctacggaaccacagtcactctg
ttctaccccgtgggtctgtcctttagacgagttgcagaaggccaagtattccttcggaag
aaagaggaccagcagtggcagcggcgtgggcagcactccctgcacctcatgtgtgacagc
accccagacaggagtcagggcctctggagtaccagctgtagcagcagacatgtcattttc
cgtggaggctcacagatgacttttttggtaacttttgacgtctcccccaaagctgagctg
ggggaccggctgcttctaagagccagagtgggaagtgagaataatgtacccggaacccca
aaaaccaccttccagttggagcttccagtaaaatatgcggtgtacaccatgatcagcagc
catgaccagtttaccaagtatcttaacttctcaacctcagaaaaggagaagaccagtgtg
gtcgaacatagattccaggtgaataacctgggccagagagacgtgccagtcagcatcaac
ttttgggtgcccatagagctgaagggagaagctgtgtggacagtgatggtctcccaccct
cagaacccactcacccaatgctatcggaatagactcaagccaacacaatttgacctcctg
actcacatgcaaaagagtcccgtgctggactgctccatcgctgactgcctgcacctccgc
tgtgacatcccctccttgggcatcctggatgagctttacttcattctgaagggcaacctc
agcttcggctggatcagtcagacattgcagaaaaaggtgttgctcctgagtgaggctgaa
atcacattcaacacatctgtgtattcccagctgccgggacaggaggcatttctgagagcc
cagacgaagacagtgctggagatgtataaagttcacaaccccgtccctcttatcgtgggc
agctcagtgggaggtctgctgctgctggctatcatcacagctatactttacaaggctggt
ttcttcaaacgtcagtacaaggagatgttggaggaagcaaatggacagtttgtctcagac
gggaccccaactccccaggttgcccagtga

DBGET integrated database retrieval system