KEGG   Mus musculus (house mouse): 16598
Entry
16598             CDS       T01002                                 
Symbol
Klf2, Lklf
Name
(RefSeq) Kruppel-like factor 2 (lung)
  KO
K17845  krueppel-like factor 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04371  Apelin signaling pathway
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    16598 (Klf2)
   04068 FoxO signaling pathway
    16598 (Klf2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16598 (Klf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16598 (Klf2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    16598 (Klf2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4
Other DBs
NCBI-GeneID: 16598
NCBI-ProteinID: NP_032478
MGI: 1342772
Ensembl: ENSMUSG00000055148
UniProt: Q60843 Q3V293
LinkDB
Position
8:73072906..73075498
AA seq 354 aa
MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSMGLDGLGAENP
PEPPPQPPPPAFYYPEPGAPPPYSIPAASLGTELLRPDLDPPQGPALHGRFLLAPPGRLV
KAEPPEVDGGGYGCAPGLAHGPRGLKLEGAPGATGACMRGPAGRPPPPPDTPPLSPDGPL
RIPASGPRNPFPPPFGPGPSFGGPGPALHYGPPAPGAFGLFEDAAAAAAALGLAPPATRG
LLTPPSSPLELLEAKPKRGRRSWPRKRAATHTCSYTNCGKTYTKSSHLKAHLRTHTGEKP
YHCNWEGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggcgctcagcgagcctatcttgccgtcctttgccactttcgccagcccgtgcgagcgc
ggcctccaggagcgctggccgcgaaatgaacccgaggcgggcggcacggatgaggaccta
aacaacgtgttggacttcatcctctccatgggattggacggtctgggcgccgaaaatcct
cccgagcccccgccgcagcccccgccgcctgccttctactacccggagccgggtgctccg
ccgccctacagcatccccgcggccagcctgggaacagagctgctgcgccccgacctggac
ccgcctcaggggccggctctgcacggccgcttcctcctcgcgcctcccgggcggctagtg
aaggccgagccccccgaggtggacggcggcggctacggctgcgctccgggcctggcccac
ggaccgcgcgggctgaagctcgagggcgccccaggagcgacaggtgcatgcatgcggggt
cccgccggccgccccccgccgcccccggacacgccgccgctcagccccgacggccccctg
cgcatcccggcgtccggtccccgcaacccgttcccgccgcccttcggtcccggccccagc
ttcggcggtcccggccccgcgttgcactacgggcctcccgcgcctggcgccttcggtctt
ttcgaggacgcggcggcagcggcggcggcgctgggcttggctccacctgccacgcgcggt
ctcctcacgccgccctcgtccccgctggagctgctggaggccaagcccaaacgcggccgc
cgctcctggccccgcaagcgcgccgccacacatacttgcagctacaccaactgcggcaag
acctacaccaagagctcgcacctaaaggcgcatctgcgtacacacacaggtgagaagcct
tatcattgcaactgggaaggatgcggctggaagttcgcgcgctctgacgagcttacccgc
cactaccgaaagcacacaggtcacagaccctttcagtgccacttgtgcgaccgggccttc
tccaggtccgaccacctggccttgcacatgaagcgacacatgtag

DBGET integrated database retrieval system